Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_049755415.1 AFER_RS07735 PLP-dependent transferase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000023265.1:WP_049755415.1 Length = 368 Score = 169 bits (427), Expect = 2e-46 Identities = 129/340 (37%), Positives = 181/340 (53%), Gaps = 26/340 (7%) Query: 65 NVYSRYTNPTVRTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGS 124 + Y R+TNPT FE I LEG AVA SG +A AL+++L G LV + Sbjct: 46 SAYGRHTNPTWEAFEALIGELEGGT-AVAFGSGAAATFALLLAL---GPRALVVADSYMG 101 Query: 125 TISLFDKYFKRF-GIQVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEI 183 T L R GI++ P SDL A P + + +E+PSNPL IA LA+ Sbjct: 102 TRQLARWLGARIPGIELVEP--SDLDAHLDRLAPGS-VVLIETPSNPLLVTYPIATLAKR 158 Query: 184 AHAKGALLAVDNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVV 243 H +G LLAVD+ TP LQ+PL LGADVV+HSA+K++ G +GGV+ E + V Sbjct: 159 IHERGGLLAVDSTLATPVLQRPLTLGADVVVHSASKFLSGHSDVLGGVLVASDEDLVARV 218 Query: 244 GFLR-TAGPTLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPS 302 G +R G + P A+L +GL TL +R++ SA+A LA L + G + V Y G S Sbjct: 219 GEVRELTGAIIGPVEAYLCFRGLRTLAVRVERASATATTLAMRLRDRLG-DTVRYPGFDS 277 Query: 303 HPQHELA--RRQQSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATT 360 EL RQQS GA+V+ +++ + A +D + T+LG ++ Sbjct: 278 ----ELVGPGRQQSAGGALVALELESAQQAD-AMLDGLSLFHHATSLGGVES-----LAE 327 Query: 361 SHGRLSPEDRARAGIGDSLIRVAVGLEDLDDLKADMARGL 400 GR EDR IG+ L+R++VGLED++DL D+ R L Sbjct: 328 RRGRYPGEDR----IGEGLVRLSVGLEDVEDLWGDLDRAL 363 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 368 Length adjustment: 30 Effective length of query: 373 Effective length of database: 338 Effective search space: 126074 Effective search space used: 126074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory