Align Phosphoserine phosphatase; PSP; EC 3.1.3.3 (characterized)
to candidate WP_050461823.1 AKL27_RS05655 HAD family hydrolase
Query= SwissProt::Q72H00 (249 letters) >NCBI__GCF_001189915.1:WP_050461823.1 Length = 236 Score = 79.0 bits (193), Expect = 8e-20 Identities = 75/248 (30%), Positives = 104/248 (41%), Gaps = 35/248 (14%) Query: 1 MKLLLLDLDDTLLQDLPVSRAVLEDLGRKAGVEGFFARVKARAEA-----LFREAPFYPW 55 +K +L DLDDTL PV + RAEA L + AP Sbjct: 5 VKAVLFDLDDTLWAIEPVLQ---------------------RAEAQLFDWLRQHAPRLAS 43 Query: 56 AEAIGHSALEALWARYSTPGLEALAAWAGPFRERVFREALEEAGGAPERARELAEAFFRE 115 ++G S E A + + WA R V +AL E+ + A F Sbjct: 44 QHSVG-SLRERRQALLAAEPAYQINLWA--LRHAVLTQALRESEEDLQLADPAMVIFTTA 100 Query: 116 RRRYPLYPEAEAFLAEARRRGLALALLTNGVPDLQREKLVGAGLAHHFSLVLISGEVGIG 175 R + + L +R L L ++NG DL+ GLA HF L + + G Sbjct: 101 RNSVEPFDDVVPGLQRLAQR-LVLGTISNGFADLKH-----IGLADHFRTSLAAHQFGSA 154 Query: 176 KPDPRLFRMALCAFGVAPEEAAMVGDNPQKDVRGARLAGVRAVWVDRGLRPEDPEASPDL 235 KPDP +F A A + P E VGD+ DV GA+ AG++AVW++R RP P PD Sbjct: 155 KPDPAIFHAACDALQLTPAETVYVGDDLTLDVLGAQQAGLQAVWMNRFNRPLPPHVKPDA 214 Query: 236 RVGDLREV 243 +L E+ Sbjct: 215 ICTNLYEL 222 Lambda K H 0.322 0.140 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 236 Length adjustment: 23 Effective length of query: 226 Effective length of database: 213 Effective search space: 48138 Effective search space used: 48138 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory