Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_050462125.1 AKL27_RS06780 2-hydroxyacid dehydrogenase
Query= BRENDA::Q9I6H5 (409 letters) >NCBI__GCF_001189915.1:WP_050462125.1 Length = 320 Score = 108 bits (269), Expect = 3e-28 Identities = 71/236 (30%), Positives = 120/236 (50%), Gaps = 7/236 (2%) Query: 85 GTNQVDLNAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWIKSAA 144 G +D A GI V N +N VA+ LA + ++R IP+ + +C G W + Sbjct: 89 GVENIDAVHAAAHGIEVANGAGTNENVVADQALALLLAVVRAIPQFDRACREGVWRDALP 148 Query: 145 NSFEIRGKKLGIVGYGSIGTQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGSLHELLGMS 204 ++ GK LG+VG G+IG +++ A A MQ+ Y ++ P + + EL S Sbjct: 149 MRPQLSGKCLGVVGLGNIGQKIARRAAAFDMQI-AYCGRSQRPDVSYPYYAHVAELAAWS 207 Query: 205 DIVSLHVPELPSTQWMIGEKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHLIGAAID 264 D++ L P +T+ ++ E++A+ G L+N RG+VV+ LA A+++ + GA +D Sbjct: 208 DVLVLATPGGAATRHLVSSAELKALGPDGYLVNIGRGSVVDTAALAQALRNGEIAGAGLD 267 Query: 265 VFPVEPKSNDEEFASPLRGLDRVILTPHIGGSTAEA-QANIGLEVAEKLVKYSDNG 319 V+ EP + L L V+L+PH+ G + EA A+I +A ++ G Sbjct: 268 VYESEPLP-----PAALLDLPNVVLSPHVAGRSPEAINASISAFMAHAARHFASRG 318 Lambda K H 0.317 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 320 Length adjustment: 29 Effective length of query: 380 Effective length of database: 291 Effective search space: 110580 Effective search space used: 110580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory