Align Homocysteine/cysteine synthase; O-acetylserine/O-acetylhomoserine sulfhydrylase; OAS-OAH SHLase; OAS-OAH sulfhydrylase; EC 2.5.1.47; EC 2.5.1.49 (characterized)
to candidate WP_050463125.1 AKL27_RS11895 cystathionine gamma-synthase family protein
Query= SwissProt::P06106 (444 letters) >NCBI__GCF_001189915.1:WP_050463125.1 Length = 413 Score = 230 bits (586), Expect = 7e-65 Identities = 135/432 (31%), Positives = 224/432 (51%), Gaps = 28/432 (6%) Query: 5 FDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNPTS 64 F T LH+ ++ + H S PI+ + ++ +++++ +++F + PGY Y R NPT Sbjct: 9 FTTTILHSDRQKSIE--HGSLHKPIHTSVAFGYKDARQLAEVFQGKQPGYRYGRQGNPTV 66 Query: 65 NVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISFKR 124 LE++I+ +E G A + ++G AA +QGL GD++VS+++L+G T N ++ Sbjct: 67 GALEDKISKMEDGIATICFATGMAAIGAVVQGLLREGDHVVSSAFLFGNT-NSLWMTVNA 125 Query: 125 FGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDN 184 G V+ + E T+ V++ETI NP+ + D ++I + + GI +VDN Sbjct: 126 QGARVSLVDATDVANVEAALTPATRIVFVETIANPRTQIADLKRIGELCRERGILYIVDN 185 Query: 185 TFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPA 244 T Y QP GA +V +S TK IGGHG +GG + D+G + W YP + + Sbjct: 186 TM-TSPYLFQPKSVGAGLVVNSLTKSIGGHGNALGGALTDTGVYDWSRYPHIADNYKRNP 244 Query: 245 EGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGENAL 304 + G I +R + LRD G + P A+ + G ET++LR ER NAL Sbjct: 245 QAQWG------------IAQIRAKALRDFGASLGPEAAHHIAVGAETMALRQERECANAL 292 Query: 305 KLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKL 364 +A+ L V+ V YPGL H H A + L +G +LSF + D + Sbjct: 293 AVAQMLSADARVAAVHYPGLPGHPQHALASE-LFRSYGSLLSFELND-----------NI 340 Query: 365 SGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFI 424 ++ ++LA +N+GD +TLVI T ++ + + A G+ + LIRVS+G+E Sbjct: 341 DCFDYLNRMQLAIPASNLGDTRTLVIPVAHTIFYEMGAERRAAMGIAESLIRVSIGLEDT 400 Query: 425 DDIIADFQQSFE 436 D++ DF+Q+ + Sbjct: 401 ADLVEDFRQALD 412 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 413 Length adjustment: 32 Effective length of query: 412 Effective length of database: 381 Effective search space: 156972 Effective search space used: 156972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory