Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_050464543.1 AKL27_RS19545 acetylglutamate kinase
Query= BRENDA::Q9HTN2 (301 letters) >NCBI__GCF_001189915.1:WP_050464543.1 Length = 296 Score = 336 bits (862), Expect = 3e-97 Identities = 163/285 (57%), Positives = 220/285 (77%), Gaps = 5/285 (1%) Query: 12 AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQ 71 A++L+EALPYIR+F GKT+V+KYGGNAM + LK GFARDV+L+K VG+NPVVVHGGGPQ Sbjct: 13 AEILAEALPYIRKFHGKTIVVKYGGNAMTEDRLKHGFARDVILLKLVGMNPVVVHGGGPQ 72 Query: 72 IGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDA 131 I + LK++ + F+ GMR+TD TM+VVE VLGG+V +DIV LIN +GG A+GLTGKD Sbjct: 73 IDNALKKIGKQGTFVQGMRITDEETMEVVEWVLGGEVQQDIVMLINHYGGQAVGLTGKDG 132 Query: 132 ELIRAKKLTVTRQTPEMTKP-EIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSN 190 LIRA+K+ + P+ KP E +DIG VGE+ +N ++ L FIP+I+PIG G + Sbjct: 133 GLIRARKM----RMPDKEKPGEFLDIGFVGEIEAINPAVVKALQDDAFIPIISPIGFGDD 188 Query: 191 GESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYG 250 G++YNINAD+VAGK+AE L AEKL+++TNIAG+ DK+G +LT LS +++E+ DGTI G Sbjct: 189 GQAYNINADVVAGKIAEILHAEKLIMMTNIAGVQDKKGNLLTDLSAREIDEMFEDGTISG 248 Query: 251 GMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLI 295 GMLPKI AL+A + GV + HIIDGR+ +++LLE+ T+ GT+I Sbjct: 249 GMLPKISSALDAAKSGVNTVHIIDGRIEHSLLLEVLTEQAFGTMI 293 Lambda K H 0.318 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 296 Length adjustment: 27 Effective length of query: 274 Effective length of database: 269 Effective search space: 73706 Effective search space used: 73706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_050464543.1 AKL27_RS19545 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.22686.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-77 245.2 3.3 3.7e-77 245.0 3.3 1.1 1 lcl|NCBI__GCF_001189915.1:WP_050464543.1 AKL27_RS19545 acetylglutamate ki Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001189915.1:WP_050464543.1 AKL27_RS19545 acetylglutamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 245.0 3.3 3.7e-77 3.7e-77 1 231 [] 30 270 .. 30 270 .. 0.97 Alignments for each domain: == domain 1 score: 245.0 bits; conditional E-value: 3.7e-77 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketl 67 tiV+K+GG+a++ +l++ +a+d++ l+ +g+++v+vHGGgp+i+++l+k+g + fv+g+R+Td+et+ lcl|NCBI__GCF_001189915.1:WP_050464543.1 30 TIVVKYGGNAMTedRLKHGFARDVILLKLVGMNPVVVHGGGPQIDNALKKIGKQGTFVQGMRITDEETM 98 69*********9989****************************************************** PP TIGR00761 68 evvemvligkvnkelvallekhgikavGltgkDgqlltaekldke.........dlgyvGeikkvnkel 127 evve vl g+v++ +v l+++ g +avGltgkDg l+ a+k+ d+g+vGei+++n+++ lcl|NCBI__GCF_001189915.1:WP_050464543.1 99 EVVEWVLGGEVQQDIVMLINHYGGQAVGLTGKDGGLIRARKMRMPdkekpgeflDIGFVGEIEAINPAV 167 ****************************************765545579******************** PP TIGR00761 128 leallkagiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGilegdkksliselele 196 ++al + +ip+i+++++ ++gq++N+naD++A+++A+ l+AekL+++t++aG+ ++ k +l++ l+++ lcl|NCBI__GCF_001189915.1:WP_050464543.1 168 VKALQDDAFIPIISPIGFGDDGQAYNINADVVAGKIAEILHAEKLIMMTNIAGVQDK-KGNLLTDLSAR 235 ********************************************************9.555******** PP TIGR00761 197 eieqlikqavikgGmipKveaalealesgvkkvvi 231 ei+++ + + i gGm pK+++al+a++sgv+ v+i lcl|NCBI__GCF_001189915.1:WP_050464543.1 236 EIDEMFEDGTISGGMLPKISSALDAAKSGVNTVHI 270 *********************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (296 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.80 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory