Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate WP_050465809.1 AKL27_RS26015 amidase
Query= curated2:Q67KJ2 (488 letters) >NCBI__GCF_001189915.1:WP_050465809.1 Length = 450 Score = 211 bits (537), Expect = 4e-59 Identities = 155/464 (33%), Positives = 224/464 (48%), Gaps = 41/464 (8%) Query: 13 AGELSAVEIAESALSRIAQVEPAVGA-FITVAADHVIERAKKLDARRKAGDTELGPLAGV 71 AG ++V + E AL RI A GA +++V A + A+ DA R AG+ LAGV Sbjct: 16 AGTTTSVRLVEQALERIDAHRAAGGAAYVSVDAQRALANARASDAARAAGNAP-SLLAGV 74 Query: 72 PIAVKDNICTSGMETTCASRILKGYV-SPFDATVVERLRAAGAMIIGKANMDEFAMGSSG 130 P+++KD +G T S+ L + DA V RLR AGA+++G+ NM EFA G Sbjct: 75 PVSIKDLFDVAGEVTAAGSKALADAAPAQQDAVAVARLRQAGAILLGRTNMSEFAFSGLG 134 Query: 131 ESSAFGVTRNPWDLERVPGGSSSGSAAAVAAGEAPLALGTDTGGSIRQPAAFTGIVGLKP 190 + +G RNP D ERV GGS+SG A +VAAG A LALGTDTGGSIR P+AF G+ G KP Sbjct: 135 LNPHYGTPRNPLDSERVSGGSTSGGAVSVAAGMAALALGTDTGGSIRIPSAFCGLTGFKP 194 Query: 191 TYGYVSRYGVVAFASSLDQVGPMGRDVEDVARLFEVIAGPDRRDATNAGRTPPALKFGGE 250 T V G V + +LD GP+G V+ +++G + P AL Sbjct: 195 TANRVDLTGAVPLSHTLDSAGPLGLSVDCCTIADAILSG------RQPEQDPVAL----- 243 Query: 251 PSLSGVRLGVPKELLGPGIDPGVKARVEEAIAQLEELGATVEECSLPSTEYALSAYYVIA 310 L+G+R GV + + G+D V+ E+A+ +L + GA + + P + + Sbjct: 244 -PLAGLRFGVTDDFVSDGMDDVVRQAFEQALTRLAQAGAQIIRFAFPELK-------DLP 295 Query: 311 VAEASSNLARFDGVRYGYRAAQAGGLHEMYSKTRGEGFGTEVKRRIMLGTYVLSAGHYDA 370 A G+ AA++ H + G+ + V RI G +A + D Sbjct: 296 AINAGG----------GFSAAESWTWHRALLQRAGDKYDARVAVRIRRGAQQTAADYLDL 345 Query: 371 YYRRAQQVRTLVVRDFERAFERYDALVTPTTPFTAWKIG--EKVDDPVSMYLGDICTIP- 427 R Q ++R R +DA + PT P I + DD G + P Sbjct: 346 LAARRQ-----LIRQAARRLSVFDAWLMPTVPVVPPLIAPLQASDDAFFAANGLVLRNPS 400 Query: 428 -VNLAGLPAVSVPCGFVDGLPVGMQLIGKPFADTQILQIAWAYQ 470 +N A+++PC GLPVG+ L G+ D +ILQI A + Sbjct: 401 VINFLDGCAINLPCPSASGLPVGISLCGQHGDDARILQIGSAVE 444 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 571 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 450 Length adjustment: 33 Effective length of query: 455 Effective length of database: 417 Effective search space: 189735 Effective search space used: 189735 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory