Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_050997279.1 FRAAL_RS27840 D-2-hydroxyacid dehydrogenase
Query= reanno::SB2B:6938941 (308 letters) >NCBI__GCF_000058485.1:WP_050997279.1 Length = 308 Score = 142 bits (358), Expect = 1e-38 Identities = 88/257 (34%), Positives = 139/257 (54%), Gaps = 6/257 (2%) Query: 57 ASGLRWMQSTFAGVDLLVKPRQR-RDYLLTNVRGIFGPLMSEYLFGYLLARQREHDLYKS 115 A L+W+ AGVD ++ P R D +LTN RG+F ++EY+ G +L ++ + Sbjct: 45 ADALQWVHVAGAGVDAVLFPALRDSDVVLTNSRGVFEGPIAEYVLGLVLTFAKDFAGTFA 104 Query: 116 QQQQKLWLPGSYKTLQGSELLLLGTGSIAKHLAQTAKHFGMKVAGINRSAKATE-GFDEV 174 Q+++ W + + GS +++ GTG I + +A+T + GM+V GI R+ + + F V Sbjct: 105 AQRERRWQHRETERIDGSAVVIAGTGPIGRAVARTLRSVGMRVEGIGRTRRDHDPDFGVV 164 Query: 175 ATLEALPTLMARADAIASILPSTEATRGILNENILARMKPDAVLFNLGRGDVLDLDALER 234 + L + AD + + P TE T G+ N + A MKP A L N+GRG ++ + L Sbjct: 165 RGFDQLTRRLPHADFVVAASPLTERTEGMFNASTFAAMKPSARLINVGRGALVVTEDLVA 224 Query: 235 QLRQHPQQQAVLDVFNQEPLPEDHPIWGLGNVIVTPHIAAP---SFPEQVAEIFSSNYHK 291 LR A LDVF+ EPLP P+W + V+V+PH++ S P +AE+F NY Sbjct: 225 ALRDGVIAGAALDVFDTEPLPTSSPLWTMPAVLVSPHMSGDFVGSLP-ALAELFVDNYRC 283 Query: 292 FLLGETLSHRVNFERGY 308 +L G L + V+ GY Sbjct: 284 WLSGNPLRNVVDKRLGY 300 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 308 Length adjustment: 27 Effective length of query: 281 Effective length of database: 281 Effective search space: 78961 Effective search space used: 78961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory