Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_051184348.1 H567_RS0100660 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000422285.1:WP_051184348.1 Length = 366 Score = 260 bits (665), Expect = 4e-74 Identities = 142/352 (40%), Positives = 208/352 (59%), Gaps = 6/352 (1%) Query: 11 RVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIMELNKG 70 R ID +DE IL L++ R ++ + K K E P RE VL+ ++E+ Sbjct: 15 RSEIDGIDEAILKLLARRQTVSRAIGNAK-----KELELPIMDPGREGHVLRRLVEIGGE 69 Query: 71 PLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMAAIDEV 130 + + + R+FREI+S+C ++++ + +AYLGP GTFS AA+ FG + +P+ +D+V Sbjct: 70 EIAPDAIRRVFREIISACRSVQEDMTIAYLGPPGTFSHQAAIAFFGQAPAFQPVDTLDDV 129 Query: 131 FREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDR 190 F V GVVP+EN+ EGAV+ TLD + I GE LRI HHLL +T ++ Sbjct: 130 FAAVEKDVCQDGVVPIENAYEGAVSRTLDLLYRSPLRIQGETFLRIRHHLLSRCSTLSE- 188 Query: 191 ITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGL 250 + +YSH +LAQCR WL ++ P V SS A AA+ E +AA+ G AA L Sbjct: 189 VRCVYSHPMALAQCRGWLRSNLPGVPCRETSSTAAAARLASEEAGAAAVGGQFAAMHLDL 248 Query: 251 SKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPFHSNGIDL 310 S L + I+D N TRFL IG +E P+G DKTS++ S+R++PG+L+E+L P NGI++ Sbjct: 249 SMLVQDIQDYADNVTRFLAIGKRENRPSGHDKTSVLFSLRHRPGSLYEVLEPLARNGINM 308 Query: 311 TRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPK 362 TRIE+RP ++ W Y+FF D GH ++ ++ L + LK LGSYPK Sbjct: 309 TRIESRPMKTKTWEYLFFADLEGHERETPLREALPVMDERCAFLKRLGSYPK 360 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 366 Length adjustment: 30 Effective length of query: 335 Effective length of database: 336 Effective search space: 112560 Effective search space used: 112560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory