Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate WP_051301747.1 A3GO_RS0101815 phosphoribosyl-AMP cyclohydrolase
Query= metacyc::HISTCYCLOPRATPPHOS (203 letters) >NCBI__GCF_000428045.1:WP_051301747.1 Length = 141 Score = 100 bits (248), Expect = 2e-26 Identities = 51/120 (42%), Positives = 73/120 (60%), Gaps = 6/120 (5%) Query: 15 TDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGETSGNFLNV 74 +DGL+P I Q +GEVLM+ +MN +LD+TLE G+V ++SR++Q+LW KGE+SG + Sbjct: 26 SDGLIPAIAQQHDTGEVLMMAWMNRVSLDETLEKGRVCYWSRSRQKLWRKGESSGQVQLL 85 Query: 75 VSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQLLAERKSADPETSY 134 + DCD DT+L+L + GP CH G +CF + E L+ DPET Y Sbjct: 86 KDMRFDCDGDTILLLVDQTGPACHTGRRTCFYNAVRGDRVEVVSEPLI------DPETLY 139 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 100 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 141 Length adjustment: 18 Effective length of query: 185 Effective length of database: 123 Effective search space: 22755 Effective search space used: 22755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory