Align ATP-dependent reduction of co(II)balamin (RamA-like) (EC:2.1.1.13) (characterized)
to candidate WP_051327315.1 G491_RS0116500 DUF4445 domain-containing protein
Query= reanno::Phaeo:GFF1501 (698 letters) >NCBI__GCF_000429905.1:WP_051327315.1 Length = 524 Score = 239 bits (611), Expect = 2e-67 Identities = 164/529 (31%), Positives = 264/529 (49%), Gaps = 31/529 (5%) Query: 152 VEVEEPDMHKPTGDMERLIEALDAQWDLKGVKTDLHILSVLQPALRKGGWKVTVAVHLGD 211 VE+ P + T +ERL L+ + D+ +L L LR G + L Sbjct: 22 VEIPAPSLENNTAFVERLCSQLEKPMGGMKISVDMEVLKALPKILRTGEGAMDCT--LFG 79 Query: 212 ENHPPKIMHIWPGFYEGSIYGLAVDLGSTTIAAHLCDLKTGDVVASSGIMNPQIRFGEDL 271 + ++ + P G + GLAVDLG+T + L D++TG V+ S NPQ R G D+ Sbjct: 80 QGGEAVLVGVAPK-KAGPLPGLAVDLGTTRVVLRLVDMRTGQVLKESSFDNPQGRIGPDV 138 Query: 272 MSRVSYSMMNKGGDQEMTRAVREGMNALFTQIAAEAEIDKALIVDAVFVCNPVMHHLFLG 331 ++R+ Y+ +GG +E+ + +G++ ++AA + + N M HL LG Sbjct: 139 LARIHYAEQ-EGGLEELQSHIGQGISQEGARLAAACGLSPKDVYCVAAAGNTAMTHLLLG 197 Query: 332 IDPFELGQAPFALATSNALALRAVELDLNIHPAARVYLLPCIAGHVGADAAAVALSEAPD 391 DP+ + + P+ ++ L+ ++ L+ +ARVY+ P + + G D A LS Sbjct: 198 ADPYWIIREPYTPMVNSPGFLKCRDIGLDFAKSARVYVFPNVGSYFGGDLLAGILSSDMY 257 Query: 392 KSEDLVLVVDVGTNAEILLGNKDKVLACSSPTGPAFEGAQISSGQRAAPGAIERVEINPE 451 ED+ ++VDVGTNAE+++GNKD ++AC+ GPA EG + G A PGAIE+V I+P+ Sbjct: 258 CKEDVSMLVDVGTNAEVVVGNKDWLMACAGAAGPALEGGVTAMGMLAGPGAIEKVRIDPK 317 Query: 452 TKEPRFRVIGSDIWSDEDGFAAAVATTGI--TGICGSGIIEAIAEMRMAGLLDASG-LIG 508 T+E F+ IG GI GICGSG+I+ A++ +AG++D G L+ Sbjct: 318 TREFVFQTIG-----------------GIKPVGICGSGVIDLAAQLFLAGMIDLRGKLVP 360 Query: 509 SAEQTGTTRCIQDGRTNAYLLWDGSVEGGPTITVTNPDIRAIQMAKAALYSGARLLMDKF 568 SA + T QD ++ G + + D+ ++ +KAA+Y+ R + + Sbjct: 361 SACEGRLTE--QDEIPALIIVSKEDSANGRALLFSQADLDSLVRSKAAMYTILRTITNTV 418 Query: 569 GIDTVD--RVVLAGAFGAHISAKHAMVLGMIPDCPLDKVTSAGNAAGTGARIALLNTEAR 626 G+ D +AG FG++I A+ +GMIPD PL + GN + GA LL EA Sbjct: 419 GLAFTDLAEFNIAGTFGSYIDPVSAITIGMIPDLPLSTYKALGNTSLEGATQVLLQREAV 478 Query: 627 SEIEATVQQIEKIETAVEPRFQEHFVNASAIPNSAEPFPILSSIVTLPE 675 + ++I +E V F F A IP++ P L V +P+ Sbjct: 479 GVVREIREKITYMELNVNQEFMNRFSAAKFIPHTN---PALFPSVKIPQ 524 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 781 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 698 Length of database: 524 Length adjustment: 37 Effective length of query: 661 Effective length of database: 487 Effective search space: 321907 Effective search space used: 321907 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
Align candidate WP_051327315.1 G491_RS0116500 (DUF4445 domain-containing protein)
to HMM PF14574 (RACo_C_ter)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF14574.10.hmm # target sequence database: /tmp/gapView.15027.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: RACo_C_ter [M=261] Accession: PF14574.10 Description: C-terminal domain of RACo the ASKHA domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-103 330.5 0.4 1.2e-102 328.5 0.1 1.9 2 lcl|NCBI__GCF_000429905.1:WP_051327315.1 G491_RS0116500 DUF4445 domain-co Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429905.1:WP_051327315.1 G491_RS0116500 DUF4445 domain-containing protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.0 0.025 0.025 182 206 .. 169 192 .. 158 196 .. 0.85 2 ! 328.5 0.1 1.2e-102 1.2e-102 2 261 .] 262 521 .. 261 521 .. 0.99 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.025 RACo_C_ter 182 kAitiGllPdlelekvkqvGNtsla 206 A Gl P+ ++ v ++GNt+++ lcl|NCBI__GCF_000429905.1:WP_051327315.1 169 LAAACGLSPK-DVYCVAAAGNTAMT 192 578899***9.999*******9986 PP == domain 2 score: 328.5 bits; conditional E-value: 1.2e-102 RACo_C_ter 2 islliDiGTNaEivlgnkdwllaasaaaGPAlEGgeikcGmrAapgAierveidpetlevelkvignek 70 +s+l+D+GTNaE+v+gnkdwl+a+++aaGPAlEGg + +Gm A pgAie+v+idp+t e+ +++ig+ k lcl|NCBI__GCF_000429905.1:WP_051327315.1 262 VSMLVDVGTNAEVVVGNKDWLMACAGAAGPALEGGVTAMGMLAGPGAIEKVRIDPKTREFVFQTIGGIK 330 79******************************************************************* PP RACo_C_ter 71 pkGicGsGiidliaelleagiidkkgklnkelkserireeeeteeyvlvlaeesetekdivitekDide 139 p+GicGsG+idl a+l++ag+id +gkl ++++ r++e++e++++++v++e+s++++ ++++++D+d+ lcl|NCBI__GCF_000429905.1:WP_051327315.1 331 PVGICGSGVIDLAAQLFLAGMIDLRGKLVPSACEGRLTEQDEIPALIIVSKEDSANGRALLFSQADLDS 399 ********************************************************************* PP RACo_C_ter 140 lirakaAiyagvktLleevglevedidkvylaGafGsyidlekAitiGllPdlelekvkqvGNtslagA 208 l+r+kaA+y++++t++++vgl+++d+ ++ +aG+fGsyid+ +AitiG++Pdl+l+++k++GNtsl+gA lcl|NCBI__GCF_000429905.1:WP_051327315.1 400 LVRSKAAMYTILRTITNTVGLAFTDLAEFNIAGTFGSYIDPVSAITIGMIPDLPLSTYKALGNTSLEGA 468 ********************************************************************* PP RACo_C_ter 209 raallsreareeleeiarkityielavekkFmeefvaalflphtdlelfpsvk 261 +++ll+rea+ ++ei++kity+el+v+++Fm++f+aa f+pht+ lfpsvk lcl|NCBI__GCF_000429905.1:WP_051327315.1 469 TQVLLQREAVGVVREIREKITYMELNVNQEFMNRFSAAKFIPHTNPALFPSVK 521 **************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (524 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 14.14 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory