Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate WP_051335510.1 METAC_RS23180 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:Q3Z6V7 (237 letters) >NCBI__GCF_000427445.1:WP_051335510.1 Length = 272 Score = 123 bits (309), Expect = 3e-33 Identities = 76/237 (32%), Positives = 128/237 (54%), Gaps = 10/237 (4%) Query: 3 IIPAIDILGGRCVRLLQGDYAQETVYSPDPVGTAMRWQSLGAPRLHVVDLDGAADGESVN 62 +IP +D+ R V+ G + + DPV A+ + S GA L +D+ + + ++ Sbjct: 6 VIPCLDVKDSRVVK---GVNFVDLRDAGDPVECAIAYDSAGADELCFLDITASHEDRAII 62 Query: 63 FELIREIANSALIPVEVGGGIRSMDTVKKLLTAGVDRVILGTVAVENPELVREICARY-A 121 F++++ A + +P+ VGGG+R+++ ++KLL AG D+V + T AV N + VRE ++ + Sbjct: 63 FDVVQRTAEACFMPLTVGGGVRTLEDIRKLLLAGADKVSIMTAAVANRDFVREAAEKFGS 122 Query: 122 DSVAVSIDARN---GK--VATRGWVNSTEVDALELARSMKKLGVKRFIYTDISRDGTLSE 176 V V+IDA+ GK + T G T +D + AR + LG + T + RDG S Sbjct: 123 QCVVVAIDAKQTGPGKWEIFTHGGRRPTGLDVIAYAREVVALGAGEILLTSMDRDGARSG 182 Query: 177 PNFAAIRDLISAINMPVIASGGVSSLSHL-RLLKDIGAEGAIVGKAIYTGDLNLKRA 232 + A R + A+ +PVIASGGV +L HL ++D GA + + G+ + A Sbjct: 183 FDIALTRAVTDAVGVPVIASGGVGTLDHLVEGVRDGGATAVLAASIFHFGEFTIGEA 239 Lambda K H 0.318 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 272 Length adjustment: 24 Effective length of query: 213 Effective length of database: 248 Effective search space: 52824 Effective search space used: 52824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory