Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_051335597.1 METAC_RS0114615 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::C3TIE2 (350 letters) >NCBI__GCF_000427445.1:WP_051335597.1 Length = 364 Score = 454 bits (1169), Expect = e-132 Identities = 228/344 (66%), Positives = 263/344 (76%) Query: 6 DDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHD 65 DDLRI EIKEL P ++ + P TE A TV +AR A+ +IL+G DDRL VVIGPCSIHD Sbjct: 17 DDLRICEIKELATPAEIIRECPRTETATKTVINARDALRRILRGEDDRLAVVIGPCSIHD 76 Query: 66 PVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRI 125 PVAA++YA RL R+ L ELEI MRVYFEKPRTTVGWKGLINDPH+D SF I+ GLRI Sbjct: 77 PVAARDYAARLAEARKRLAGELEIFMRVYFEKPRTTVGWKGLINDPHLDGSFAIDQGLRI 136 Query: 126 ARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGF 185 AR LLLD+ND GLPA EFLDMITPQY+ADL+SWGAIGARTTESQVHRELASGLSCP+GF Sbjct: 137 ARGLLLDVNDLGLPAGCEFLDMITPQYIADLVSWGAIGARTTESQVHRELASGLSCPIGF 196 Query: 186 KNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPNYSAKH 245 KNGTDG +++A+DA+ AA PH FL+VTK G SAI +T+GN DCHIILRGG PNY A Sbjct: 197 KNGTDGNVRIAVDAVKAASCPHHFLAVTKTGQSAIASTAGNEDCHIILRGGNAPNYDAAS 256 Query: 246 VAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVESHL 305 VA K+G+ +MID SHANS K+ + Q V DV QIA GE+ IIGVM+ESHL Sbjct: 257 VASACAEAVKSGVTPLLMIDASHANSRKKPENQGQVIEDVAAQIAAGEQRIIGVMIESHL 316 Query: 306 VEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARR 349 G Q L G+PL YG+SITD CI WE + ALL +LA AV ARR Sbjct: 317 RAGRQDLVPGQPLVYGQSITDGCIDWESSVALLERLAQAVAARR 360 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 364 Length adjustment: 29 Effective length of query: 321 Effective length of database: 335 Effective search space: 107535 Effective search space used: 107535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_051335597.1 METAC_RS0114615 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.25186.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-165 533.8 0.0 7.7e-165 533.7 0.0 1.0 1 lcl|NCBI__GCF_000427445.1:WP_051335597.1 METAC_RS0114615 3-deoxy-7-phosph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000427445.1:WP_051335597.1 METAC_RS0114615 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 533.7 0.0 7.7e-165 7.7e-165 1 342 [] 17 360 .. 17 360 .. 0.99 Alignments for each domain: == domain 1 score: 533.7 bits; conditional E-value: 7.7e-165 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyak 69 ddlri +i+el+tP+e++++ p te+a+++v+++r+++ +il+G+ddrl vviGPcsihdp aa +ya lcl|NCBI__GCF_000427445.1:WP_051335597.1 17 DDLRICEIKELATPAEIIRECPRTETATKTVINARDALRRILRGEDDRLAVVIGPCSIHDPVAARDYAA 85 799****************************************************************** PP TIGR00034 70 rlkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplate 138 rl++ +++l +lei mrvyfekPrttvGWkGlindP+l++sf +++Glriar llld+++lglp+++e lcl|NCBI__GCF_000427445.1:WP_051335597.1 86 RLAEARKRLAGELEIFMRVYFEKPRTTVGWKGLINDPHLDGSFAIDQGLRIARGLLLDVNDLGLPAGCE 154 ********************************************************************* PP TIGR00034 139 lldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsv 207 +ld+i+pqy+adl+swgaiGarttesqvhrelasgls+p+gfkngtdG++++a+da++aa+ +h+fl+v lcl|NCBI__GCF_000427445.1:WP_051335597.1 155 FLDMITPQYIADLVSWGAIGARTTESQVHRELASGLSCPIGFKNGTDGNVRIAVDAVKAASCPHHFLAV 223 ********************************************************************* PP TIGR00034 208 tkaGqvaivetkGnedghiilrGGkkpnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlev 276 tk+Gq+ai +t+Gned+hiilrGG++pnyda++va++++e k g ++ lmid+sh+ns+k+ ++q +v lcl|NCBI__GCF_000427445.1:WP_051335597.1 224 TKTGQSAIASTAGNEDCHIILRGGNAPNYDAASVASACAEAVKSGVTPLLMIDASHANSRKKPENQGQV 292 ********************************************************************* PP TIGR00034 277 aesvveqiaeGekaiiGvmiesnleeGnqsl..keelkyGksvtdacigwedteallrklaeavkerr 342 e+v++qia Ge+ iiGvmies+l+ G+q+l +++l+yG+s+td ci+we++ all++la+av +rr lcl|NCBI__GCF_000427445.1:WP_051335597.1 293 IEDVAAQIAAGEQRIIGVMIESHLRAGRQDLvpGQPLVYGQSITDGCIDWESSVALLERLAQAVAARR 360 ******************************9999******************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.64 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory