Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate WP_051377926.1 H566_RS22575 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >NCBI__GCF_000482785.1:WP_051377926.1 Length = 507 Score = 491 bits (1265), Expect = e-143 Identities = 241/397 (60%), Positives = 304/397 (76%), Gaps = 7/397 (1%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGAS--KAIAL 59 K+VLAYSGGLDTS+ILKWL++ Y+ EV+ FTADIGQGEEVE AR+KA+ G Sbjct: 7 KVVLAYSGGLDTSVILKWLQDVYQCEVVTFTADIGQGEEVEPARKKAIALGIKPENIFIQ 66 Query: 60 DLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKG 119 DL+EEFVRDFVFPM RA VYEG YLLGTSIARPLIAK L+ IA++ GA+AI+HGATGKG Sbjct: 67 DLREEFVRDFVFPMFRANTVYEGEYLLGTSIARPLIAKQLIEIAKKTGADAISHGATGKG 126 Query: 120 NDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEK----PYSMD 175 NDQVRFEL AYAL P++KVIAPWREW R++++AYA+AH IPV + K PYSMD Sbjct: 127 NDQVRFELGAYALLPNVKVIAPWREWDLLSREKLLAYADAHKIPVDFKKRKGGGAPYSMD 186 Query: 176 ANLLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSP 235 ANLLHISYEGG+LEDP P M+R+T PE+AP P+ +E+ + +GD VA++G+RL P Sbjct: 187 ANLLHISYEGGILEDPNFAPEDNMWRLTVSPEKAPGKPQIIELTYEKGDVVAIDGQRLKP 246 Query: 236 AALLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVL 295 +L LN++GG+HG+GR+D+VENR+VGMKSRG YETPGGTIL RA+ES+TLDREV+ Sbjct: 247 HEVLDTLNKLGGKHGIGRLDLVENRYVGMKSRGCYETPGGTILLKGHRAIESITLDREVV 306 Query: 296 HQRDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPK 355 +D L P+YA ++Y G+W++PERE LQ D V G +LKLYKG + VVGR++ Sbjct: 307 ALKDDLMPRYARMIYNGYWFSPERELLQGLIDASQAKVNGTVKLKLYKGTIMVVGRESAN 366 Query: 356 SLYRQDLVSFDEAGG-YDQKDAEGFIKIQALRLRVRA 391 SL+ + +FD+ GG Y+Q DA GFIK+ ALRLR+ A Sbjct: 367 SLFDAKISTFDDDGGAYNQADAGGFIKLNALRLRIAA 403 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 630 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 507 Length adjustment: 33 Effective length of query: 367 Effective length of database: 474 Effective search space: 173958 Effective search space used: 173958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_051377926.1 H566_RS22575 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.26664.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-141 456.1 0.0 8e-141 455.8 0.0 1.0 1 lcl|NCBI__GCF_000482785.1:WP_051377926.1 H566_RS22575 argininosuccinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000482785.1:WP_051377926.1 H566_RS22575 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 455.8 0.0 8e-141 8e-141 1 392 [. 7 405 .. 7 407 .. 0.96 Alignments for each domain: == domain 1 score: 455.8 bits; conditional E-value: 8e-141 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGa..ekayviDareefvk 66 kvvlaysGGlDtsv+lk+l++ +ev+++t+d+Gq+ e+++ +++ka++lG e+ + D reefv+ lcl|NCBI__GCF_000482785.1:WP_051377926.1 7 KVVLAYSGGLDTSVILKWLQDVyQCEVVTFTADIGQG-EEVEPARKKAIALGIkpENIFIQDLREEFVR 74 8*********************899***********9.9*************733577788******** PP TIGR00032 67 dylfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdl 135 d++f+ +an+vyeg+Yll+t++aRpliak+l+e+akk ga+a++hG+tgKGnDqvRFel ++l p++ lcl|NCBI__GCF_000482785.1:WP_051377926.1 75 DFVFPMFRANTVYEGEYLLGTSIARPLIAKQLIEIAKKTGADAISHGATGKGNDQVRFELGAYALLPNV 143 ********************************************************************* PP TIGR00032 136 kviaPvreleli.ReeeieyaaekGievpvekek....aysiDenllgrsiEageLEdpsteppediye 199 kviaP+re++l Re++++ya ++ i+v +k k +ys+D nll++s+E+g+LEdp+++p +++++ lcl|NCBI__GCF_000482785.1:WP_051377926.1 144 KVIAPWREWDLLsREKLLAYADAHKIPVDFKKRKgggaPYSMDANLLHISYEGGILEDPNFAPEDNMWR 212 **********987*****************998766669****************************** PP TIGR00032 200 lvkdpiektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsRei 268 l+++p++++ +p+++e+++ekG va++g++l+p e++ ++n+++gkhG+Gr+D vE+R++g+KsR++ lcl|NCBI__GCF_000482785.1:WP_051377926.1 213 LTVSPEKAP-GKPQIIELTYEKGDVVAIDGQRLKPHEVLDTLNKLGGKHGIGRLDLVENRYVGMKSRGC 280 ***998887.*********************************************************** PP TIGR00032 269 YEapalllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvr 337 YE+p+ ++L+k h+++e+ +l+++v+ +k+ +y+++iY+G+wf+p++e l+ li+ +q +v+Gtv+ lcl|NCBI__GCF_000482785.1:WP_051377926.1 281 YETPGGTILLKGHRAIESITLDREVVALKDDLMPRYARMIYNGYWFSPERELLQGLIDASQAKVNGTVK 349 ********************************************************************* PP TIGR00032 338 vklfkGnaivigrkseyslYdeelvsfek.dkefdqkdaiGfikirglqikvyrek 392 +kl+kG+ +v+gr+s +sl+d+++++f+ +++q da Gfik+++l+ ++ ++k lcl|NCBI__GCF_000482785.1:WP_051377926.1 350 LKLYKGTIMVVGRESANSLFDAKISTFDDdGGAYNQADAGGFIKLNALRLRIAANK 405 ****************************8446799*************99887665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (507 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 8.12 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory