Align anthranilate synthase (subunit 1/2) (EC 4.1.3.27) (characterized)
to candidate WP_051678576.1 N746_RS0107335 hypothetical protein
Query= BRENDA::P20580 (492 letters) >NCBI__GCF_000711195.1:WP_051678576.1 Length = 474 Score = 239 bits (610), Expect = 2e-67 Identities = 161/412 (39%), Positives = 226/412 (54%), Gaps = 31/412 (7%) Query: 89 DCADPLAFVEEFKARYQ-VPTVPGLPR---FDGGLVGYFGYDCVRYVEKRLATCPNPDPL 144 D +FVE+F+ + + PGL F GG GYF Y+ + VE L + PL Sbjct: 68 DLNSATSFVEQFETEFSSLEQTPGLVDDLPFSGGWFGYFSYEYAQVVEPCLNLAESTLPL 127 Query: 145 GNPDILLMVSDAVVVFDNLAGKIHAIVLADPSEENAYERGQARLEELLERLRQPITPRRG 204 +L A++V +L +A+P + E Q + + ++ P R Sbjct: 128 A---VLQRFPAAIIVDHHLQ---QVCFVAEPEYADCVEHMQ---RDYAQFVQPPQAERAS 178 Query: 205 LDLEAAQGREPAFRASFTREDYENAVGRIKDYILAGDCMQVVPSQRMSIEF--KAAPIDL 262 +E A E A + V IK+YILAGD QV S+ I+ K+ PID+ Sbjct: 179 FAIEVAGVSEEA------EPSFLQGVEGIKNYILAGDVFQVNLSREWQIDLAKKSRPIDV 232 Query: 263 YRALRCFNPTPYMYFFNF----GDFH----VVGSSPEVLVR--VEDGLVTVRPIAGTRPR 312 YR LR NP P+ F G+F ++ SSPE LVR + V RPIAGTR R Sbjct: 233 YRQLRQHNPAPFACLVQFSQPAGNFPDPWAIISSSPERLVRYSAQTQCVDTRPIAGTRKR 292 Query: 313 GINEEADLALEQDLLSDAKEIAEHLMLIDLGRNDVGRVSDIGAVKVTEKMVIERYSNVMH 372 + D AL ++L+S KE AEH+MLIDL RND+GR+ + G+V+V E MVIE Y +V H Sbjct: 293 SDSLVQDQALMEELISHPKERAEHIMLIDLERNDLGRICEPGSVEVNELMVIETYEHVHH 352 Query: 373 IVSNVTGQLREGLSAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGYLAW 432 IVSNV GQL+ G+S + + A+ P GT++G PKIR M+II ELE R Y G+VGY+ Sbjct: 353 IVSNVRGQLKRGISPLQVVHALFPGGTITGCPKIRCMQIISELESGPRDAYTGSVGYINR 412 Query: 433 NGNMDTAIAIRTAVIKNGELHVQAGGGIVADSVPALEWEETINKRRAMFRAV 484 +G+MD I IR+ + + +L +AG GIVADSV + E +ET +K + + RA+ Sbjct: 413 DGSMDFNILIRSFIQQQDQLRFRAGAGIVADSVASGELKETRHKAKGLLRAL 464 Lambda K H 0.321 0.139 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 474 Length adjustment: 34 Effective length of query: 458 Effective length of database: 440 Effective search space: 201520 Effective search space used: 201520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory