Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_051955498.1 DL88_RS02250 ornithine carbamoyltransferase
Query= BRENDA::Q98BB6 (303 letters) >NCBI__GCF_000745425.1:WP_051955498.1 Length = 318 Score = 403 bits (1036), Expect = e-117 Identities = 202/301 (67%), Positives = 237/301 (78%), Gaps = 3/301 (0%) Query: 5 HFTDLSTVSEGDLRFMLDDAVVRKARLKAGE--RTRPLEGKVLAMIFDKPSTRTRVSFDV 62 HF DLS + +LR +LD A KAR + G+ R RPLEG+ LAM+FD+PSTRTRVSFD+ Sbjct: 15 HFLDLSQLDTAELRAILDLAAEFKARRRRGQKSRERPLEGRTLAMVFDQPSTRTRVSFDL 74 Query: 63 GMRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHDRLLELTENATVPV 122 GMR+LGGETIMLTG EMQLGR ETIADTA+VLSR+VD+I+IR H LLEL E+A VPV Sbjct: 75 GMRELGGETIMLTGQEMQLGRGETIADTARVLSRFVDSIVIRILDHANLLELAEHAEVPV 134 Query: 123 INGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNVAV 182 INGLT +HPCQ+MADI+TFEEHRGP+ G+TIAWTGD NNVL S +EA+ RF F LNVA Sbjct: 135 INGLTKRSHPCQIMADILTFEEHRGPIKGRTIAWTGDSNNVLASWIEAARRFDFTLNVAC 194 Query: 183 PEGSEPAQKHIDWSKAHGGKLHFTRSPEEAVDQADCVVTDCWVSMGQE-HRARGHNVFSP 241 PE PAQ + ++ AH K+H R P EAV AD V++DCWVSMG E AR H + +P Sbjct: 195 PEELTPAQDLLAFANAHEKKVHVLRDPFEAVSGADAVISDCWVSMGDEAEEARRHALLAP 254 Query: 242 YQVNAKLMAHAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWCL 301 +QVNA+LMA A DA+F+HCLPAHRGEEVTDEVIDGP SVVFDEAENRLHAQK +LAWC Sbjct: 255 FQVNARLMATAAKDAVFLHCLPAHRGEEVTDEVIDGPQSVVFDEAENRLHAQKGILAWCF 314 Query: 302 G 302 G Sbjct: 315 G 315 Lambda K H 0.320 0.133 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 318 Length adjustment: 27 Effective length of query: 276 Effective length of database: 291 Effective search space: 80316 Effective search space used: 80316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_051955498.1 DL88_RS02250 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.21405.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-114 366.3 0.0 6.6e-114 366.1 0.0 1.0 1 lcl|NCBI__GCF_000745425.1:WP_051955498.1 DL88_RS02250 ornithine carbamoyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745425.1:WP_051955498.1 DL88_RS02250 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 366.1 0.0 6.6e-114 6.6e-114 2 303 .. 15 314 .. 14 315 .. 0.97 Alignments for each domain: == domain 1 score: 366.1 bits; conditional E-value: 6.6e-114 TIGR00658 2 hllslldlseeelkellelakklkkekkkgke..ekklkgktlaliFekrstRtRvsfevaayelGaqv 68 h+l+l +l+++el+ +l+la+++k+++++g++ e+ l+g+tla++F+++stRtRvsf+ ++ elG+++ lcl|NCBI__GCF_000745425.1:WP_051955498.1 15 HFLDLSQLDTAELRAILDLAAEFKARRRRGQKsrERPLEGRTLAMVFDQPSTRTRVSFDLGMRELGGET 83 9************************999887655899******************************** PP TIGR00658 69 lylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDll 137 ++l +e+qlgr+e+i+Dtarvlsr+vd+iv+R +h ++ ela++a+vPvingLt +hPcqi+aD+l lcl|NCBI__GCF_000745425.1:WP_051955498.1 84 IMLTGQEMQLGRGETIADTARVLSRFVDSIVIRILDHANLLELAEHAEVPVINGLTKRSHPCQIMADIL 152 ********************************************************************* PP TIGR00658 138 tikeklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklel 206 t +e+ g +k+ ++++ GD+nnv s + aa + ++++va+Pe+l+p ++++ a ++++ k+++ lcl|NCBI__GCF_000745425.1:WP_051955498.1 153 TFEEHRGPIKGRTIAWTGDSNNVLASWIEAARRFDFTLNVACPEELTPAQDLLAFA----NAHEKKVHV 217 ***************************************************99776....668889*** PP TIGR00658 207 tedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtde 275 ++dp +av++ad + D wvsmG+e++++ r +ll p+qvn +l+++a ++++flhCLPa+rGeevtde lcl|NCBI__GCF_000745425.1:WP_051955498.1 218 LRDPFEAVSGADAVISDCWVSMGDEAEEARRHALLAPFQVNARLMATAAKDAVFLHCLPAHRGEEVTDE 286 ********************************************************************* PP TIGR00658 276 vlegeasivfdeaenRlhaqkavlkall 303 v++g++s+vfdeaenRlhaqk++l++++ lcl|NCBI__GCF_000745425.1:WP_051955498.1 287 VIDGPQSVVFDEAENRLHAQKGILAWCF 314 ************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (318 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.87 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory