Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_052367888.1 U743_RS10230 dihydrodipicolinate synthase family protein
Query= BRENDA::Q9I4W3 (292 letters) >NCBI__GCF_000733765.1:WP_052367888.1 Length = 291 Score = 161 bits (407), Expect = 2e-44 Identities = 109/293 (37%), Positives = 160/293 (54%), Gaps = 5/293 (1%) Query: 1 MIAGSMVALVTPFDAQGRLDWDSLAKLVDFHLQEGTNAIVAVGTTGESATLDVEEHIQVI 60 MI GS+V L+TP + G + + +L+++H+++G++AIV T SA LD EE ++ Sbjct: 1 MIKGSIVDLITPTHSGGAPSYTDMERLIEWHVEQGSSAIVIGSTMDSSADLDGEECYELF 60 Query: 61 RRVVDQVKGRIPVIAGTGANSTREAVALTEAAKSGGADACLLVTPYYNKPTQEGMYQHFR 120 RR V Q GRI V+A A++T+ A A A DA LL P P + + +HF+ Sbjct: 61 RRTVWQADGRIAVVADISADTTKGARASLRTAYDAVVDAVLLTIPVAGCPDHDALLKHFQ 120 Query: 121 HIAEAVAIPQILYNVPGRTSCDMLP-ETVERLSKVPNIIGIKEATGDLQRAKEVIERVGK 179 IA A +P L P R+ D+LP +++L+++ I G+ E + + ++ Sbjct: 121 TIARAAKMPVYLREHPERS--DLLPYAVIKQLAQIDGINGLIERGVNSEAPPALLGLDWP 178 Query: 180 D-FLVYSGDDATAVELMLLGGKGNISVTANVAPRAMSDLCAAAMRGDAAAARAINDRLMP 238 D F +Y+G A +LM+ G G +SV ANVAP + LC AAM GD A+ L P Sbjct: 179 DGFGLYAGAYRGAAKLMMEGFHGVVSVMANVAPAQVQALCTAAMNGDQDQVDALEAVLKP 238 Query: 239 LHKALFIESNPIPVKWALHEMGLIPEGIRLPLTWLSPRCHEPLRQAMRQTGVL 291 LH+AL I V+WAL EMGLI EG+R P S + LR+A+R VL Sbjct: 239 LHEALQAHPYDITVQWALIEMGLIDEGLRPPALPQSAD-YATLRRALRGAHVL 290 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 291 Length adjustment: 26 Effective length of query: 266 Effective length of database: 265 Effective search space: 70490 Effective search space used: 70490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory