Align Methionine synthase component, B12 binding and B12-binding cap domains (EC:2.1.1.13) (characterized)
to candidate WP_052665966.1 NITAL_RS09160 5-methyltetrahydrofolate--homocysteine methyltransferase
Query= reanno::Phaeo:GFF1319 (233 letters) >NCBI__GCF_000969705.1:WP_052665966.1 Length = 233 Score = 325 bits (834), Expect = 4e-94 Identities = 159/225 (70%), Positives = 192/225 (85%) Query: 3 EDADDIILADLNDEDLVQQMFDDLYDGLKEEIEESVNILLERGWAPYKVLTEALVGGMTI 62 E AD++ L L++++LV+QM +DLYDG ++I E ILLERGW P +VL EALV GM I Sbjct: 4 EPADELDLRGLDEQELVEQMHEDLYDGRADDIAEGTEILLERGWGPKRVLDEALVEGMRI 63 Query: 63 VGADFRDGILFVPEVLLAANAMKGGMAILKPLLAETGAPRMGSMVIGTVKGDIHDIGKNL 122 VG DFRDG+LFVPEVLLAANAMK GMA+L+PLLAETGA +G +VIGTVKGDIHDIGKNL Sbjct: 64 VGIDFRDGVLFVPEVLLAANAMKAGMALLRPLLAETGAQPIGKVVIGTVKGDIHDIGKNL 123 Query: 123 VSMMMEGAGFEVVDIGINNPVENYLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIEQG 182 V+MM+EGAGFEVVDIGIN V++Y+ AL+EH+PDILGMSALLTTTMPYMKVV+DT+ E+G Sbjct: 124 VAMMLEGAGFEVVDIGINTDVDSYIAALDEHRPDILGMSALLTTTMPYMKVVLDTLKEKG 183 Query: 183 KRDDYIVLVGGAPLNEEFGKAIGADGYCRDAAVAVEMAKDFVARK 227 +RD++IVLVGGAPLNEEFG+AIGAD YCRDAA+A E A + + Sbjct: 184 RRDEFIVLVGGAPLNEEFGEAIGADAYCRDAAMAAETATRLIRER 228 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 233 Length adjustment: 23 Effective length of query: 210 Effective length of database: 210 Effective search space: 44100 Effective search space used: 44100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory