Align diaminopimelate decarboxylase subunit (EC 4.1.1.20) (characterized)
to candidate WP_052666188.1 NITAL_RS10480 diaminopimelate decarboxylase
Query= metacyc::MONOMER-6601 (439 letters) >NCBI__GCF_000969705.1:WP_052666188.1 Length = 433 Score = 385 bits (988), Expect = e-111 Identities = 204/431 (47%), Positives = 279/431 (64%), Gaps = 7/431 (1%) Query: 6 TSRQNQHGHLEIGGVDALYLAEKYGTPLYVYDVALIRERAKSFKQAFISAGLKAQVAYAS 65 T+ +++ G L IGG LA +GTPL+V D A +RER + + F VAYAS Sbjct: 8 TAERDEDGVLHIGGAAVTDLARDHGTPLWVVDEADLRERCRRYVTGFPGV----DVAYAS 63 Query: 66 KAFSSVAMIQLAEEEGLSLDVVSGGELYTAVAAGF-PAERIHFHGNNKSREELRMALEHR 124 KA+ +V ++QL E+EGL +DV S GEL+TA+ AG PA+ IH HGNNK EL +AL+ Sbjct: 64 KAWCTVGLLQLVEDEGLLVDVASEGELHTALVAGVDPAKLIH-HGNNKGDAELDLALKVG 122 Query: 125 IGCIVVDNFYEIALLEDLCKETGHSIDVLLRITPGVEAHTHDYITTGQEDSKFGFDLHNG 184 +G IVVD+F E+ LE L V LRITPG++AHTH+Y+ TG +D+KFGF L G Sbjct: 123 LGRIVVDSFDELDRLERLAAARDIVAQVWLRITPGIDAHTHEYVRTGHDDAKFGFTLSLG 182 Query: 185 QTERAIEQVLQSEHIQLLGVHCHIGSQIFDTAGFVLAAEKIFKKLDEWRDSYSFVSKVLN 244 + A+ EHI+++G+H HIGSQIF T F+ A+ L WRD + V LN Sbjct: 183 LADEAVLAARDLEHIEVVGIHAHIGSQIFGTDPFIANADVCLDLLARWRDEHGIVLSELN 242 Query: 245 LGGGFGIRYTEDDEPLHATEYVEKIIEAVKENASRYGFDIPEIWIEPGRSLVGDAGTTLY 304 LGGG GIRYT +D P+ Y + ++EAV++ R F P + +EPGR++VG + TLY Sbjct: 243 LGGGMGIRYTHEDHPVEVKRYGKAVLEAVEDACERLDFPRPRLIVEPGRAIVGPSTLTLY 302 Query: 305 TVGSQKEVPGVRQYVAVDGGMNDNIRPALYQAKYEAAAANRIGEAHDKTVSIAGKCCESG 364 +G+ K +PG+ +V+VDGGM DNIRPALY A +E ANR EA + V++ GK CESG Sbjct: 303 EIGTIKPLPGLTTWVSVDGGMGDNIRPALYDAVHEVTLANRTSEAEPQAVTVVGKHCESG 362 Query: 365 DMLIWDIDLP-EVKEGDLLAVFCTGAYGYSMANNYNRIPRPAVVFVENGEAHLVVKRETY 423 D++ LP ++ GDLLAV TGAY SMA+NYN +PRP V V++G+A +V+RET Sbjct: 363 DLVREHAPLPGDLAVGDLLAVAATGAYTASMASNYNLLPRPGAVLVKDGQARELVRRETL 422 Query: 424 EDIVKLDLPFK 434 ED+V+ D+P + Sbjct: 423 EDLVRRDVPIR 433 Lambda K H 0.319 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 564 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 433 Length adjustment: 32 Effective length of query: 407 Effective length of database: 401 Effective search space: 163207 Effective search space used: 163207 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_052666188.1 NITAL_RS10480 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.1805.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-141 457.9 0.0 1.4e-141 457.7 0.0 1.0 1 lcl|NCBI__GCF_000969705.1:WP_052666188.1 NITAL_RS10480 diaminopimelate de Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000969705.1:WP_052666188.1 NITAL_RS10480 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 457.7 0.0 1.4e-141 1.4e-141 3 416 .. 11 429 .. 9 430 .. 0.98 Alignments for each domain: == domain 1 score: 457.7 bits; conditional E-value: 1.4e-141 TIGR01048 3 ekkdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllae 71 +++dg l i+g+++++la+ +gtPl+v+de++lrer++++ + f + v+YA+KA+ + +l+l+++ lcl|NCBI__GCF_000969705.1:WP_052666188.1 11 RDEDGVLHIGGAAVTDLARDHGTPLWVVDEADLRERCRRYVTGFPGV--DVAYASKAWCTVGLLQLVED 77 6899****************************************864..8******************* PP TIGR01048 72 eGlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgk 140 eGl +dv s+GEl +al Agv++ k++++gn+k ++el al+++ i+vds++el++le++a+ + lcl|NCBI__GCF_000969705.1:WP_052666188.1 78 EGLLVDVASEGELHTALVAGVDPAKLIHHGNNKGDAELDLALKVGLGRIVVDSFDELDRLERLAAARDI 146 ********************************************************************* PP TIGR01048 141 karvllRvnpdvdaktheyisTGlkesKFGieve..eaeeayelalkleslelvGihvHIGSqildlep 207 a+v+lR++p++da+they+ TG+ + KFG++++ a ea+ +a +le++e+vGih+HIGSqi+ ++p lcl|NCBI__GCF_000969705.1:WP_052666188.1 147 VAQVWLRITPGIDAHTHEYVRTGHDDAKFGFTLSlgLADEAVLAARDLEHIEVVGIHAHIGSQIFGTDP 215 ********************************9988999****************************** PP TIGR01048 208 fveaaekvvklleelkee.gieleeldlGGGlgisyeeeeeapdleeyaeklleklekea.elgl.klk 273 f++ a+ ++ll+++++e gi l+el+lGGG+gi+y++e+++++++ y +++le++e+++ +l + +++ lcl|NCBI__GCF_000969705.1:WP_052666188.1 216 FIANADVCLDLLARWRDEhGIVLSELNLGGGMGIRYTHEDHPVEVKRYGKAVLEAVEDACeRLDFpRPR 284 ***************9999*****************************************999999*** PP TIGR01048 274 lilEpGRslvanagvlltrVesvKeves.rkfvlvDagmndliRpalYeayheiaalkrleeeetetvd 341 li+EpGR++v++++ +l++++++K + +++v+vD+gm d+iRpalY+a+he+++++r++e+e + v+ lcl|NCBI__GCF_000969705.1:WP_052666188.1 285 LIVEPGRAIVGPSTLTLYEIGTIKPLPGlTTWVSVDGGMGDNIRPALYDAVHEVTLANRTSEAEPQAVT 353 *************************9988**************************************** PP TIGR01048 342 vvGplCEsgDvlakdrelp.eveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretl 409 vvG++CEsgD++ + lp + Gdllava++GAY+asm+snYn prp +vlv++g+ar ++rretl lcl|NCBI__GCF_000969705.1:WP_052666188.1 354 VVGKHCESGDLVREHAPLPgDLAVGDLLAVAATGAYTASMASNYNLLPRPGAVLVKDGQARELVRRETL 422 *******************999*********************************************** PP TIGR01048 410 edllale 416 edl++ + lcl|NCBI__GCF_000969705.1:WP_052666188.1 423 EDLVRRD 429 ****987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (433 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.64 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory