Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate WP_052666196.1 NITAL_RS10525 homoserine kinase
Query= curated2:A5CQ46 (316 letters) >NCBI__GCF_000969705.1:WP_052666196.1 Length = 330 Score = 171 bits (434), Expect = 2e-47 Identities = 128/314 (40%), Positives = 167/314 (53%), Gaps = 27/314 (8%) Query: 9 RRVQVRVPATSANLGPGFDTLGLALALYDDLT-------VTVRDAP-GATVD---VRGVG 57 R V VPAT+ANLGPGFD GLALA + T + VR P GA + G G Sbjct: 5 RHHAVAVPATTANLGPGFDAFGLALA--EPATGGTGVARLVVRSLPRGAQAERVLTLGEG 62 Query: 58 AGEVPTDETNLVVTAIAHTFAAFDQPMPGLDLVAENRIPHGRGLGSSGAAIVSGIMAAQG 117 AGEV TD+ NLV ++ +D P+P + L A+NRIP RGLGSS AIV+G++ + Sbjct: 63 AGEVATDDDNLVWRSLVRFCDHYDVPVPDVALQADNRIPLERGLGSSSGAIVAGLVLGRA 122 Query: 118 LLAGTVEIDADALLRLATEMEGHPDNVAPALFGGLTIAWVDGQGPQHKKLAVHR-----G 172 L V + LL LAT +EGHPDNV PAL GGL +A DG L V R Sbjct: 123 LT--DVVLGDRELLGLATTIEGHPDNVGPALLGGL-VACADGDDGD---LVVRRVNPAPA 176 Query: 173 VSPLVLVPVATMSTALARSLQPESVPHEDAIFNVSRSALLIAALIQSPELLLAATEDRLH 232 + P+VLVP +T AR++ PE + D +R+ ++ AL + DRLH Sbjct: 177 LRPVVLVPATRQATTSARAVLPEQLSRADVAVQAARAGHVLTALTGVWPAAVGLAGDRLH 236 Query: 233 QDYRAAAMPETNELVHLLRERGYAAVVSGAGPSL-LVLGSDPGQRLTAAELVAERSTNPW 291 + R AAMP T +V LR G A +SGAGPS+ V+ PG VAER + + Sbjct: 237 EPARFAAMPATGAVVDELRRAGIHAWLSGAGPSVAAVVTGAPGATSGVLAGVAER--HGF 294 Query: 292 TALMLAVDVKGSTV 305 LA+D+ G+ V Sbjct: 295 VVHHLAMDLAGAVV 308 Lambda K H 0.316 0.132 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 330 Length adjustment: 28 Effective length of query: 288 Effective length of database: 302 Effective search space: 86976 Effective search space used: 86976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_052666196.1 NITAL_RS10525 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.4009.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-57 178.5 0.0 9.3e-57 178.1 0.0 1.1 1 lcl|NCBI__GCF_000969705.1:WP_052666196.1 NITAL_RS10525 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000969705.1:WP_052666196.1 NITAL_RS10525 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 178.1 0.0 9.3e-57 9.3e-57 3 268 .. 9 277 .. 7 309 .. 0.85 Alignments for each domain: == domain 1 score: 178.1 bits; conditional E-value: 9.3e-57 TIGR00191 3 vkvPassANlgpGfDvlGlalslvle..llvtedv....aqeskdksleaegegvekipkesdkNliyq 65 v vPa++ANlgpGfD +Glal + v v ++ + + + geg+ ++ ++ d+Nl+ + lcl|NCBI__GCF_000969705.1:WP_052666196.1 9 VAVPATTANLGPGFDAFGLALAEPATggTGVARLVvrslPRGAQAERVLTLGEGAGEVATD-DDNLVWR 76 89*******************98764222222222122233333346999**********9.******* PP TIGR00191 66 vakkvlkklgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEgHpD 134 +++++++++ v+ v+l+ ++ ipl rGLGSS+ aiva+++++ +l++ l + ell la+++EgHpD lcl|NCBI__GCF_000969705.1:WP_052666196.1 77 SLVRFCDHYDVPVPDVALQADNRIPLERGLGSSSGAIVAGLVLGRALTDVVLGDRELLGLATTIEGHPD 145 ********************************************************************* PP TIGR00191 135 NvapallGGlqlavkedd.llevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshla 202 Nv+pallGGl++ dd l+v +v ++l v+ +P T aRavLP++ sr+d+ ++++++ lcl|NCBI__GCF_000969705.1:WP_052666196.1 146 NVGPALLGGLVACADGDDgDLVVRRVNPAPALRPVVLVPATRQATTSARAVLPEQLSRADVAVQAARAG 214 *************99999755555554469*************************************** PP TIGR00191 203 vlvtAlvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeee 268 + tAl+ + + + Dr+h+p R +P+ ++ + + +g+ lSGaGp++ a+ + lcl|NCBI__GCF_000969705.1:WP_052666196.1 215 HVLTALTGV--WPAAVGLAGDRLHEPARFAAMPATGAVVDELRRAGIH-AWLSGAGPSVAAVVTGA 277 ******999..666777889*************************876.57*******99987655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (330 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.37 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory