Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_052667356.1 NITAL_RS16755 aspartate carbamoyltransferase catalytic subunit
Query= curated2:Q3A9W4 (311 letters) >NCBI__GCF_000969705.1:WP_052667356.1 Length = 324 Score = 132 bits (333), Expect = 8e-36 Identities = 97/316 (30%), Positives = 156/316 (49%), Gaps = 31/316 (9%) Query: 8 RDFLSMNDLTGEEIEEVLDLASEL-KIRQKKGISTPILKGKTLAMIFSKNSTRTRVSFEV 66 R +S+ DL +++ +LD A +L I +++ S P L+G + F ++STRTR+SF++ Sbjct: 18 RHLISIEDLDRDQLTNLLDTAQQLLPIAERRVKSAPTLRGMVVCNFFLEDSTRTRISFDI 77 Query: 67 GMVQLGGYPLFITATDSQLSRGEPIADTARVLSRM-VDGIMIRTYSHSEVEELAYYADVP 125 +L + + S +S+GE DTA L+ M VD ++IR+ S +LA Y DVP Sbjct: 78 AAKRLSAEVINFSGKGSSVSKGESFKDTALTLAAMGVDAVVIRSGSSGAPVQLASYLDVP 137 Query: 126 VIN-GLTDYEHPCQIMADLLTIKEHKGQLRGLKVAWVGD--GNNVCHSLMIGAAKVGMEV 182 V+N G ++HP Q + D+ T+++H G L G +A VGD + V SL+ A GMEV Sbjct: 138 VLNAGDGWHQHPTQALLDVFTMRQHLGSLDGRHLAVVGDVLHSRVARSLIQAAKLSGMEV 197 Query: 183 AVATPPGYEPDQKVSLIAQKETSRWGTKLLLTHDPVEAVTGADVVVTDVWASMGQEAESA 242 + PP P + WG V D V+ +V A + Sbjct: 198 TLVAPPTLLP---------PSVADWG---------VHVARDLDAVLPEVDAVELLRVQRE 239 Query: 243 ERVKVFEP--------YQVNGELVSHAKQDFIFLHCLPAHRGEEVTAEVIDGEHSVVFAE 294 + F P + ++ ++ K D I LH P +RG E++A+V D + +V+ + Sbjct: 240 RMHRAFFPTTREYAAEWGLDARRLTLLKPDAIVLHPGPMNRGVEISADVADADQAVITEQ 299 Query: 295 AENRLHAQKAILTLLL 310 N + + A L LLL Sbjct: 300 VTNGIAVRMACLYLLL 315 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 324 Length adjustment: 27 Effective length of query: 284 Effective length of database: 297 Effective search space: 84348 Effective search space used: 84348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory