Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_052667489.1 NITAL_RS17575 phosphoserine transaminase
Query= BRENDA::P9WQ73 (376 letters) >NCBI__GCF_000969705.1:WP_052667489.1 Length = 372 Score = 405 bits (1041), Expect = e-118 Identities = 202/374 (54%), Positives = 272/374 (72%), Gaps = 5/374 (1%) Query: 5 LTPHLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSG 64 + P L IP + P DGRFG GPSK+R E ++ L A+ L GTSHR+ VK V R++ G Sbjct: 1 MAPDLTIPDDLLPADGRFGCGPSKIRPEAVERLAEVASDLLGTSHRKPAVKGQVQRLQEG 60 Query: 65 LAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNPFVGE 124 L+ LF LP+GYEV++ GGATAFWDAAAFGL+++RS H ++GEFS+KFA A + P++ + Sbjct: 61 LSGLFGLPEGYEVLVTLGGATAFWDAAAFGLVEQRSRHYSFGEFSSKFAKATAAAPWLSD 120 Query: 125 PIIITSDPGSAPEPQTDPS-VDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSGAGG 183 P +++++PG+ P P+ VDV A+ HNETSTGV ++ P +DDALV++DATSGAGG Sbjct: 121 PDVVSAEPGTRPTASAAPADVDVQAFTHNETSTGV---MQDPVRTDDALVLVDATSGAGG 177 Query: 184 LPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVEN 243 LPVD+ +TD YYF+ QK FAS+GGL +A++SPAA+ RIEAIAA+ R+VP FL L A+ N Sbjct: 178 LPVDLTQTDVYYFSLQKGFASEGGLTVALVSPAAVQRIEAIAASDRYVPTFLDLSTALSN 237 Query: 244 SLKNQTYNTPAIATLALLAEQIDWLVGN-GGLDWAVKRTADSSQRLYSWAQERPYTTPFV 302 + ++QTYNTP+++T+ L AEQ+DW+ GGLD V + + +Y WA +R + +PFV Sbjct: 238 ARQHQTYNTPSVSTVFLAAEQVDWMRATFGGLDGVVAAQREKAAHVYGWANDRAWASPFV 297 Query: 303 TDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDV 362 T+ RS VV TID D V A V +LRANG++DT+ YRKLGRNQLR+ MFPAV+ D+ Sbjct: 298 TEDAARSLVVATIDLDDSVPADDVNAVLRANGVLDTDAYRKLGRNQLRIGMFPAVDAADL 357 Query: 363 SALTECVDWVVERL 376 A T VDWVVERL Sbjct: 358 QAYTASVDWVVERL 371 Lambda K H 0.317 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 372 Length adjustment: 30 Effective length of query: 346 Effective length of database: 342 Effective search space: 118332 Effective search space used: 118332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_052667489.1 NITAL_RS17575 (phosphoserine transaminase)
to HMM TIGR01366 (putative phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01366.hmm # target sequence database: /tmp/gapView.15423.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01366 [M=361] Accession: TIGR01366 Description: serC_3: putative phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-160 520.5 3.3 1.4e-160 520.3 3.3 1.0 1 lcl|NCBI__GCF_000969705.1:WP_052667489.1 NITAL_RS17575 phosphoserine tran Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000969705.1:WP_052667489.1 NITAL_RS17575 phosphoserine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 520.3 3.3 1.4e-160 1.4e-160 2 361 .] 13 371 .. 12 371 .. 0.98 Alignments for each domain: == domain 1 score: 520.3 bits; conditional E-value: 1.4e-160 TIGR01366 2 padgrfgagpskvrleqlqalvataasllgtshrqaavknlvgkvreglaelfslpdgyevilgnggat 70 padgrfg+gpsk+r+e+++ l++ a+ llgtshr++avk v +++egl+ lf lp+gyev++++ggat lcl|NCBI__GCF_000969705.1:WP_052667489.1 13 PADGRFGCGPSKIRPEAVERLAEVASDLLGTSHRKPAVKGQVQRLQEGLSGLFGLPEGYEVLVTLGGAT 81 9******************************************************************** PP TIGR01366 71 afwdaatfgliekkslhlsfgefsskfakaaklapfldepeivtadpgsapeaqae.egvdvialahne 138 afwdaa+fgl+e++s+h sfgefsskfaka+ ap+l++p +v+a+pg+ p a a + vdv a++hne lcl|NCBI__GCF_000969705.1:WP_052667489.1 82 AFWDAAAFGLVEQRSRHYSFGEFSSKFAKATAAAPWLSDPDVVSAEPGTRPTASAApADVDVQAFTHNE 150 ***************************************************99876267********** PP TIGR01366 139 tstgvavavrrpegsdealvvidatsgagglpvdiketdvyyfapqksfasdgglwlavlspaalerie 207 tstgv+ p +d+alv++datsgagglpvd+++tdvyyf+ qk fas+ggl +a++spaa++rie lcl|NCBI__GCF_000969705.1:WP_052667489.1 151 TSTGVMQD---PVRTDDALVLVDATSGAGGLPVDLTQTDVYYFSLQKGFASEGGLTVALVSPAAVQRIE 216 *****965...55579***************************************************** PP TIGR01366 208 kiaasgrfvpeflslptavdnslknqtyntpavatlllldeqvdwlngn.ggldfavartkdsssrlys 275 +iaas+r+vp fl+l ta+ n+++ qtyntp+v+t++l +eqvdw+ + ggld++va ++ + ++y lcl|NCBI__GCF_000969705.1:WP_052667489.1 217 AIAASDRYVPTFLDLSTALSNARQHQTYNTPSVSTVFLAAEQVDWMRATfGGLDGVVAAQREKAAHVYG 285 **********************************************8654******************* PP TIGR01366 276 waeereyatpfvadaakrsqvvgtidfsddidaavvakilrangivdtepyrklgrnqlrvamfpaidp 344 wa++r a+pfv++ a rs+vv tid++d++ a v +lrang++dt+ yrklgrnqlr++mfpa+d+ lcl|NCBI__GCF_000969705.1:WP_052667489.1 286 WANDRAWASPFVTEDAARSLVVATIDLDDSVPADDVNAVLRANGVLDTDAYRKLGRNQLRIGMFPAVDA 354 ********************************************************************* PP TIGR01366 345 advealteavdfvvekl 361 ad++a t +vd+vve+l lcl|NCBI__GCF_000969705.1:WP_052667489.1 355 ADLQAYTASVDWVVERL 371 ***************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.33 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory