Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (characterized)
to candidate WP_052667665.1 NITAL_RS18710 anthranilate synthase component I
Query= SwissProt::P20579 (493 letters) >NCBI__GCF_000969705.1:WP_052667665.1 Length = 515 Score = 380 bits (975), Expect = e-110 Identities = 229/508 (45%), Positives = 299/508 (58%), Gaps = 30/508 (5%) Query: 3 REEFLRLAAVGYNRIPLACETLADFDTPLSIYLKL-----------ADQPNSYLLESVQG 51 REEF+ A + +P+ E LAD +TPLS++ KL A P S+LLES + Sbjct: 7 REEFVA-HATDHGVVPVWREVLADLETPLSVFAKLGGAAAGGAADGAIPPRSFLLESAEH 65 Query: 52 GEKWGRYSMIGL-PSRTVMRVHGYHVSILHDGVEVES-HDVEDPLAFVESFKDRYKVADI 109 GE+WGRYS IG P T++ G + +G + PL + D Y+ + Sbjct: 66 GERWGRYSFIGFDPFLTLLGRDG---EVSWEGTPPAGCAEATGPLDALARATDAYRAPQL 122 Query: 110 PGLPRFNGGLVGYFGYDCVRYVEKRLGVSPNPDPLGVPDILLMVSDAVVVFDNLAGKMHA 169 LP +GG VG+ GYD VR +E + + D LG+PD++++ VV D+ M Sbjct: 123 LDLP-LHGGAVGFIGYDAVREIE--VIPATGRDDLGMPDVVMLFPRHVVALDHARQVMTV 179 Query: 170 IVLV---DPAEEQAFEQGQ------ARLQGLLETLRQPITPRRGLDLSGPQAAEPEFRSS 220 + V D A E G A G+++ L P + + A P S+ Sbjct: 180 VTNVTVDDLTSADADELGARYDAAVAATDGVVDRLAAAAPPLPPV-APPERVAPPRVPSN 238 Query: 221 YTREDYENAVGRIKEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNF 280 +YE V +KE+I AGD Q V SQR S+D DLYR LR NP+PY+Y + Sbjct: 239 LAEGEYEQLVEVVKEHIRAGDTFQTVVSQRFSVDTTVTAFDLYRVLRVINPSPYLYLLDL 298 Query: 281 GDFHVVGSSPEVLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLI 340 GD +VGSSPE LV+V+ + V PIAGTRPRGAT DR E L++D KE AEH+ML+ Sbjct: 299 GDAQIVGSSPEALVQVQGDHVETWPIAGTRPRGATPAEDREHERSLMADAKERAEHVMLV 358 Query: 341 DLGRNDVGRVSSTGSVRLTEKMVIERYSNVMHIVSNVAGQLREGLTAMDALRAILPAGTL 400 DL RND+GRV TGSV + + M +ERYS+VMH+VS+V+G LREGLT +D LRA+ PAGT+ Sbjct: 359 DLARNDIGRVCETGSVTVDDLMHVERYSHVMHLVSSVSGTLREGLTPVDVLRAVFPAGTV 418 Query: 401 SGAPKIRAMEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVINDGELHVQAGGGI 460 SGAPK+RAM+IIDELEP +RG Y GAVGY + GN+DT I IRT V+ DG HVQAG GI Sbjct: 419 SGAPKVRAMQIIDELEPTRRGPYAGAVGYVDFAGNLDTCITIRTVVLKDGVAHVQAGAGI 478 Query: 461 VADSVPALEWEETINKRRAMFRAVALAE 488 VADS P E EET +K A+ AV AE Sbjct: 479 VADSRPTSEEEETRSKAGAVLAAVQAAE 506 Lambda K H 0.320 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 712 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 493 Length of database: 515 Length adjustment: 34 Effective length of query: 459 Effective length of database: 481 Effective search space: 220779 Effective search space used: 220779 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate WP_052667665.1 NITAL_RS18710 (anthranilate synthase component I)
to HMM TIGR00564 (trpE: anthranilate synthase component I (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00564.hmm # target sequence database: /tmp/gapView.13588.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00564 [M=455] Accession: TIGR00564 Description: trpE_most: anthranilate synthase component I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-169 550.8 0.0 1.7e-169 550.6 0.0 1.0 1 lcl|NCBI__GCF_000969705.1:WP_052667665.1 NITAL_RS18710 anthranilate synth Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000969705.1:WP_052667665.1 NITAL_RS18710 anthranilate synthase component I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 550.6 0.0 1.7e-169 1.7e-169 2 454 .. 29 502 .. 28 503 .. 0.93 Alignments for each domain: == domain 1 score: 550.6 bits; conditional E-value: 1.7e-169 TIGR00564 2 dtltpisvylklakr...........kesfllEsvekeeelgRySliglnpvleikakdgkavlleadd 59 d +tp+sv+ kl + sfllEs+e++e++gRyS+ig +p+l++ +dg++ + + lcl|NCBI__GCF_000969705.1:WP_052667665.1 29 DLETPLSVFAKLGGAaaggaadgaipPRSFLLESAEHGERWGRYSFIGFDPFLTLLGRDGEVSWEGTPP 97 7899999999999844799999999999********************************888888777 PP TIGR00564 60 eeakieedelkelrkllekaeesedeldeplsggavGylgydtvrlveklkeeaedelelpdlllllve 128 + + +l++l + ++++ + ld pl ggavG++gyd vr +e ++++ +d+l +pd+++l+ + lcl|NCBI__GCF_000969705.1:WP_052667665.1 98 AGCAEATGPLDALARATDAYR-APQLLDLPLHGGAVGFIGYDAVREIEVIPATGRDDLGMPDVVMLFPR 165 77779999***9999999965.566799***************************************** PP TIGR00564 129 tvivfDhvekkvilienarteaers........aeeeaaarleellaelqkelekavkaleekkes... 186 +v++ Dh ++ +++++n++ ++ +s +++a a+ + ++ +l ++ + ++ +++++ lcl|NCBI__GCF_000969705.1:WP_052667665.1 166 HVVALDHARQVMTVVTNVTVDDLTSadadelgaRYDAAVAATDGVVDRLAAAAPPLPPVAPPERVAppr 234 *****************9988877777778887667777778888888888777665555544444555 PP TIGR00564 187 ftsnvekeeyeekvakakeyikaGdifqvvlSqrleakveakpfelYrkLRtvNPSpylyyldledfel 255 + sn+ + eye+ v+ +ke+i+aGd fq v+Sqr+++++++++f+lYr+LR++NPSpyly ldl d ++ lcl|NCBI__GCF_000969705.1:WP_052667665.1 235 VPSNLAEGEYEQLVEVVKEHIRAGDTFQTVVSQRFSVDTTVTAFDLYRVLRVINPSPYLYLLDLGDAQI 303 99******************************************************************* PP TIGR00564 256 vgsSPEllvkvkgkrvetrPiAGtrkRGatkeeDealeeeLladeKerAEHlmLvDLaRNDigkvaklg 324 vgsSPE+lv+v+g++vet PiAGtr+RGat++eD+ e+ L+ad KerAEH+mLvDLaRNDig+v+++g lcl|NCBI__GCF_000969705.1:WP_052667665.1 304 VGSSPEALVQVQGDHVETWPIAGTRPRGATPAEDREHERSLMADAKERAEHVMLVDLARNDIGRVCETG 372 ********************************************************************* PP TIGR00564 325 svevkellkiekyshvmHivSeVeGelkdeltavDalraalPaGTlsGAPKvrAmelidelEkekRgiY 393 sv v++l+++e+yshvmH+vS+V+G+l+++lt+vD+lra++PaGT+sGAPKvrAm++idelE+++Rg+Y lcl|NCBI__GCF_000969705.1:WP_052667665.1 373 SVTVDDLMHVERYSHVMHLVSSVSGTLREGLTPVDVLRAVFPAGTVSGAPKVRAMQIIDELEPTRRGPY 441 ********************************************************************* PP TIGR00564 394 gGavgylsfdgdvdtaiaiRtmvlkdgvayvqAgaGiVaDSdpeaEyeEtlnKakallrai 454 +Gavgy++f+g++dt+i+iRt+vlkdgva+vqAgaGiVaDS p++E eEt Ka a+l a+ lcl|NCBI__GCF_000969705.1:WP_052667665.1 442 AGAVGYVDFAGNLDTCITIRTVVLKDGVAHVQAGAGIVADSRPTSEEEETRSKAGAVLAAV 502 ********************************************************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (515 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 7.48 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory