Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate WP_052717740.1 OLEAN_RS00180 homoserine kinase
Query= curated2:Q9RAM6 (319 letters) >NCBI__GCF_000967895.1:WP_052717740.1 Length = 340 Score = 229 bits (583), Expect = 9e-65 Identities = 129/335 (38%), Positives = 179/335 (53%), Gaps = 32/335 (9%) Query: 1 MSVFTTVSFEQMQQWLKGYDLGELLDLQGIASGITNTNYFVTTDNGRYVLTLFEEHSAEE 60 MSV+T +S ++ +L + LG+ D QGI++G+ NTN+FV +YVLT+FE HSA+E Sbjct: 1 MSVYTDLSASEVAAYLSQFSLGDYDDHQGISAGVENTNFFVVAGGHKYVLTIFEHHSAKE 60 Query: 61 LPNFLDLMTHLAERGIPCPHPVKNNAGRALGELNGKPAALVSCLAGRSLDNPMPQHCAAI 120 + NF+ + HLAE+G+P P P+ + G L L KPA L CL G + HC I Sbjct: 61 VENFIKVGRHLAEQGVPVPGPIADAQGLYLHSLKNKPAILCPCLPGSHPEQITADHCQQI 120 Query: 121 GEVLARMHIAGASFKAGMSNLRGQEW-----------RIATAAKVAPFLDEENHRMLDAQ 169 G LAR H+AG + N RG +W +AT + L EE +L + Sbjct: 121 GAALARFHLAGEGLDSLEENNRGLQWWPEVGRELIQANMATGLQKVALLTEEQQEILIDE 180 Query: 170 LEFE--RTFDTRRLPRGVIHADLFRDNVLM----------DGDKVGGVIDFYYACHDALL 217 +EF+ T LPRG+IH DLF DN L DGDK+G ++D Y +C DA L Sbjct: 181 IEFQESNTELWYELPRGLIHGDLFHDNALFEIVEFKSTETDGDKLGAILDIYNSCQDAWL 240 Query: 218 YDIAIAVNDWCVNADCTLDAVRVRAFLDAYHAIRPLTGEEHAAWPGMLRVAAMRFWLSRL 277 +D+AI NDWC N+ + A + Y ++R LT E AW LR AA+RFWLSR+ Sbjct: 241 FDLAIVANDWCANSAGVWQEGNLPALMAGYQSVRELTTLEQQAWGMCLRAAALRFWLSRM 300 Query: 278 NDLYF--------PQAGELTHAKDP-AYFERILKH 303 P A +T KDP YF ++++H Sbjct: 301 MTQQHQAEAIAKDPMAALVTTTKDPMEYFLKLVRH 335 Lambda K H 0.324 0.137 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 340 Length adjustment: 28 Effective length of query: 291 Effective length of database: 312 Effective search space: 90792 Effective search space used: 90792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory