Align acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17] (characterized)
to candidate WP_053768359.1 BVI061214_RS10655 aspartate aminotransferase family protein
Query= reanno::azobra:AZOBR_RS19025 (389 letters) >NCBI__GCF_001280255.1:WP_053768359.1 Length = 414 Score = 254 bits (650), Expect = 2e-72 Identities = 156/381 (40%), Positives = 219/381 (57%), Gaps = 15/381 (3%) Query: 13 DIVFERGEGPYLYATDGRRFLDFAAGVAVNVLGHANPYLVEALTAQAHKLWHTSNLFRVA 72 D V EGPY++ T G+R+LDF LGH +P +VEA+ AQ ++ + + Sbjct: 27 DRVESHAEGPYVWDTTGKRYLDFLGLYGALNLGHRHPKVVEAVMAQLARMPMSVRVLVSE 86 Query: 73 GQESLAKRLTEAT--FADTVFFTNSGAEAWECGAKLIRKYHYEKGDKARTRIITFEQAFH 130 LA +L E T + VFF NSGAEA E KL R Y + G IIT E FH Sbjct: 87 PTARLAAKLAEITPEGLEMVFFGNSGAEAVEAAIKLARAYTGKPG------IITTEGGFH 140 Query: 131 GRTLAAVSAAQQEKLIKGFGPLLDGFDLVPFGDLEAVRNAVTDETAGICLEPIQGEGGIR 190 G+T+ A+S + + PLL G +VP+GDLEA+ A+ +TA + +EPIQGEGGIR Sbjct: 141 GKTMGALSLTPRPQYQDPARPLLPGVKVVPYGDLEALEAAIDGDTAAVIVEPIQGEGGIR 200 Query: 191 AGSVEFLRGLREICDEHGLLLFLDEIQCGMGRTGKLFAHEWAGITPDVMAVAKGIGGG-F 249 +LRG+REI + G+L+ DE+Q G+GRTG+LF +W G+ PD+M +AK +GGG Sbjct: 201 VPPEGYLRGVREITRKRGVLMIADEVQTGLGRTGRLFGVDWEGVAPDLMTLAKALGGGVM 260 Query: 250 PLGACLATEKAASGMTAGT--HGSTYGGNPLATAVGNAVLDKVLEPGFLDHVQRIGGLLQ 307 P+GAC+ + H ST+GGNPLA A A ++ LE +GGLL Sbjct: 261 PIGACVGRREVFEIFRQNPLFHSSTFGGNPLAAAAALAAIEVTLEEDLPRRALEMGGLLM 320 Query: 308 DRLAGLVAENPAVFKGVRGKGLMLGLACGPA-VGDVVVA-LRANGLLSVPAGDN--VVRL 363 + L L A P + + VRG+GLMLG+ A +G +VVA L G+++ +N VVRL Sbjct: 321 EGLKALKARYPHLIEDVRGRGLMLGVEFTDADIGALVVAELAERGVITAFGLNNPKVVRL 380 Query: 364 LPPLNIGEAEVEEAVAILAKT 384 PPL IG V+EA++ +++ Sbjct: 381 EPPLIIGREHVDEALSAFSES 401 Lambda K H 0.321 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 414 Length adjustment: 31 Effective length of query: 358 Effective length of database: 383 Effective search space: 137114 Effective search space used: 137114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory