Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate WP_053768359.1 BVI061214_RS10655 aspartate aminotransferase family protein
Query= curated2:C3P3K3 (396 letters) >NCBI__GCF_001280255.1:WP_053768359.1 Length = 414 Score = 298 bits (762), Expect = 3e-85 Identities = 167/384 (43%), Positives = 234/384 (60%), Gaps = 19/384 (4%) Query: 15 GANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTL 74 G + L V S AEG +V D G RY+D L Y A+N GHRHPK++ A++ Q R+ + Sbjct: 19 GLLRFTGLDRVESHAEGPYVWDTTGKRYLDFLGLYGALNLGHRHPKVVEAVMAQLARMPM 78 Query: 75 TSRAFHSDQLGPWYEKVAKLTNK--EMVLPMNTGAEAVETAIKTARRWAYDVKKVEANRA 132 + R S+ K+A++T + EMV N+GAEAVE AIK AR + + Sbjct: 79 SVRVLVSEPTARLAAKLAEITPEGLEMVFFGNSGAEAVEAAIKLARAYT--------GKP 130 Query: 133 EIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYGDLEALKAAITPNTAAFIL 192 II E FHG+TMGA+S++ +Y+ P+LPG+ V+PYGDLEAL+AAI +TAA I+ Sbjct: 131 GIITTEGGFHGKTMGALSLTPRPQYQDPARPLLPGVKVVPYGDLEALEAAIDGDTAAVIV 190 Query: 193 EPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYI 252 EPIQGE GI +PP G+L+ E+ +K VL +ADE+QTGLGRTG++F DW+ V PD+ Sbjct: 191 EPIQGEGGIRVPPEGYLRGVREITRKRGVLMIADEVQTGLGRTGRLFGVDWEGVAPDLMT 250 Query: 253 LGKALGGGVFPISCAAANRDILGVF--EPGSHGSTFGGNPLACAVSIAALEVLEEEKLTE 310 L KALGGGV PI R++ +F P H STFGGNPLA A ++AA+EV EE L Sbjct: 251 LAKALGGGVMPIGACVGRREVFEIFRQNPLFHSSTFGGNPLAAAAALAAIEVTLEEDLPR 310 Query: 311 RSLQLGEKLVGQLKEID---NPMITEVRGKGLFIGIELNEP--ARPYCEQLKAAGLLCKE 365 R+L++G L+ LK + +I +VRG+GL +G+E + +L G++ Sbjct: 311 RALEMGGLLMEGLKALKARYPHLIEDVRGRGLMLGVEFTDADIGALVVAELAERGVITAF 370 Query: 366 THEN--VIRIAPPLVISEEDLEWA 387 N V+R+ PPL+I E ++ A Sbjct: 371 GLNNPKVVRLEPPLIIGREHVDEA 394 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 414 Length adjustment: 31 Effective length of query: 365 Effective length of database: 383 Effective search space: 139795 Effective search space used: 139795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory