Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_055067583.1 M72_RS06160 ornithine carbamoyltransferase
Query= metacyc::ORNCARBAMTRANSFERST-MONOMER (332 letters) >NCBI__GCF_001406815.1:WP_055067583.1 Length = 329 Score = 390 bits (1002), Expect = e-113 Identities = 202/331 (61%), Positives = 248/331 (74%), Gaps = 4/331 (1%) Query: 3 VSLKGRSFLTLKHFTPEEINYLLDLSADLKAKKRAGIKGNLLEGKNVVLLFEKTSTRTRC 62 ++LKGR+ L + FTPEEI YL+DLSA+LK KK GI + L GKN+ L+FEKTSTRTRC Sbjct: 1 MTLKGRNLLKMMDFTPEEILYLVDLSAELKEKKHQGIMHDSLVGKNIALIFEKTSTRTRC 60 Query: 63 AFEVGVLDEGGHVTFLGSGDSQMGKKESIEDTAKVLGRFYDGIEFRGFKQETVEILAANA 122 +FEV D G HVT+L SQ+GKKESI DTA+VLGR +DGIE+RG+ QE VE LA A Sbjct: 61 SFEVAAHDLGMHVTYLDPSGSQIGKKESIPDTARVLGRMFDGIEYRGYGQEIVEELAKYA 120 Query: 123 GVPVWNGLTDLYHPTQILADFLTIKEHVAKPLNKVKFVYAGDARNNMGNSLMIGAAKMGM 182 GVPVWNGLT+ HPTQ++AD LTIKEH+ K L VKFVY GDAR NMGNSLM+ AK+GM Sbjct: 121 GVPVWNGLTNESHPTQMIADMLTIKEHLGK-LKGVKFVYMGDARYNMGNSLMVTCAKLGM 179 Query: 183 EFWGLAPKELWPSEELVAEMKEVAKETGASINFSENV-DDVKNADVIYTDVWVSMGE-EA 240 F + +P ++LV +VA TGASI +++V + ++ADVIYTDVWVSMGE E Sbjct: 180 HFVACTNPKYYPDKKLVDYCVDVASTTGASITLTDSVAEATRDADVIYTDVWVSMGEPEE 239 Query: 241 MFEERIKQLKPYQVNMDMIKKTENPDVLFLHCLPAFHDLNTTVGKDIYEKFGLESMEVTD 300 ++ ERI LKPYQVN D K ++ +F+HCLPAFHDL TT+GK +YEKFGL +EVTD Sbjct: 240 VWAERINDLKPYQVNADAFKNAKD-SAIFMHCLPAFHDLKTTIGKQVYEKFGLSELEVTD 298 Query: 301 EVFRSRHSKVFDEAENRMHTIKAVMVATIGN 331 EVF S S VFDEAENRMH+IKA+M AT+ + Sbjct: 299 EVFESERSVVFDEAENRMHSIKAIMKATLSD 329 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 329 Length adjustment: 28 Effective length of query: 304 Effective length of database: 301 Effective search space: 91504 Effective search space used: 91504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_055067583.1 M72_RS06160 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.1172070.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-134 431.8 0.1 7.3e-134 431.7 0.1 1.0 1 NCBI__GCF_001406815.1:WP_055067583.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001406815.1:WP_055067583.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 431.7 0.1 7.3e-134 7.3e-134 1 303 [. 6 327 .. 6 328 .. 0.99 Alignments for each domain: == domain 1 score: 431.7 bits; conditional E-value: 7.3e-134 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvlylnk 73 r+ll+++d+++ee+ +l++l+++lk++k++g ++ l gk++aliFek+stRtR+sfevaa +lG +v+yl++ NCBI__GCF_001406815.1:WP_055067583.1 6 RNLLKMMDFTPEEILYLVDLSAELKEKKHQGIMHDSLVGKNIALIFEKTSTRTRCSFEVAAHDLGMHVTYLDP 78 78*********************************************************************** PP TIGR00658 74 eelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltikeklgkl 146 + +q+g+kesi Dtarvl+r++d+i +R+y +e+veelakya+vPv+ngLt+++hP+q++aD+ltike+lgkl NCBI__GCF_001406815.1:WP_055067583.1 79 SGSQIGKKESIPDTARVLGRMFDGIEYRGYGQEIVEELAKYAGVPVWNGLTNESHPTQMIADMLTIKEHLGKL 151 ************************************************************************* PP TIGR00658 147 kevklvyvGDa.nnvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkavkdad 218 k+vk+vy+GDa n++nsl++++aklG+++v +t +++ p++++v+ + ++a+ +g++++lt+ +++a++dad NCBI__GCF_001406815.1:WP_055067583.1 152 KGVKFVYMGDArYNMGNSLMVTCAKLGMHFVACTNPKYYPDKKLVDYCVDVASTTGASITLTDSVAEATRDAD 224 ***********99************************************************************ PP TIGR00658 219 viytDvwvsmGe.eekkeerlkllkpyqvneellelakpevkflhCLPavr.................Geevt 273 viytDvwvsmGe ee ++er++ lkpyqvn + ++ ak++++f+hCLPa++ evt NCBI__GCF_001406815.1:WP_055067583.1 225 VIYTDVWVSMGEpEEVWAERINDLKPYQVNADAFKNAKDSAIFMHCLPAFHdlkttigkqvyekfglsELEVT 297 ************9999*************************************************99889*** PP TIGR00658 274 devlegeasivfdeaenRlhaqkavlkall 303 dev+e+e+s+vfdeaenR+h++ka++ka+l NCBI__GCF_001406815.1:WP_055067583.1 298 DEVFESERSVVFDEAENRMHSIKAIMKATL 327 ***************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (329 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 25.15 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory