Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate WP_058929288.1 AU252_RS01965 imidazole glycerol phosphate synthase subunit HisF
Query= curated2:Q2S296 (258 letters) >NCBI__GCF_001484605.1:WP_058929288.1 Length = 258 Score = 103 bits (256), Expect = 5e-27 Identities = 66/218 (30%), Positives = 108/218 (49%), Gaps = 27/218 (12%) Query: 4 VIPAIDIRDGRCVRLHQGDYDNETVYFE------DPVKMAKLWRVQNAQTLHVVDLDAAR 57 VIP +D+ GR V+ + FE DPV++A + A L +D+ A+ Sbjct: 7 VIPCLDVDAGRVVK---------GINFEGLRDAGDPVELAHRYDNAGADELTFLDVTASS 57 Query: 58 GEGEHNRDVIGKMCDALDIPIQLGGGIRSMDQIEAALDRGVYRVILGTAAVRNPDFVERA 117 G E DV+ + + + IP+ +GGG+R + +++ L G + + TAAV PD + Sbjct: 58 GNRETTFDVVRRTAEEVFIPLTVGGGVRGVAEVDKLLRFGADKASINTAAVARPDVINEI 117 Query: 118 VEQFSARRVVVSIDAR-----------DGEVRVQGWTEGSGLDAVAFAKDMEQRGVRRLV 166 F ++ +V+S+DAR EV G G+G+DA+ +A++ RG+ ++ Sbjct: 118 SRHFGSQVLVLSVDARRTRPGSQPTPSGFEVTTHGGRTGTGIDAIEWAREAADRGIGEIL 177 Query: 167 YTDISRDGTMDGPNIQAYRTLGRQLAHAKVTASGGVGE 204 I DGT DG +++ R L R + ASGG GE Sbjct: 178 LNSIDADGTKDGFDLELIR-LVRAAVKVPIIASGGAGE 214 Lambda K H 0.321 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory