Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_058929976.1 AU252_RS06200 phosphoserine transaminase
Query= BRENDA::P9WQ73 (376 letters) >NCBI__GCF_001484605.1:WP_058929976.1 Length = 376 Score = 461 bits (1185), Expect = e-134 Identities = 222/369 (60%), Positives = 277/369 (75%), Gaps = 1/369 (0%) Query: 9 LEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAEL 68 + IP + P+DGRFG+GPSKVR EQL+ L+ + + GTSHRQAPVKNLVG VR GL++ Sbjct: 6 ITIPADLLPKDGRFGAGPSKVRPEQLEALSAASKTILGTSHRQAPVKNLVGSVREGLSQF 65 Query: 69 FSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNPFVGEPIII 128 F P+GYEV+LG GG+TAFWD A+FGL++K++ HL++GEF +KFASA +K PF+ II Sbjct: 66 FRAPEGYEVVLGVGGSTAFWDVASFGLVEKKAQHLSFGEFGSKFASATNKAPFLDASSII 125 Query: 129 TSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSD-DALVVIDATSGAGGLPVD 187 S+PG+ P + VDV AW NETSTGVA V+R G+D +LV++DATS AGGL VD Sbjct: 126 KSEPGTRPVSAAEAGVDVYAWPQNETSTGVAAPVKRVAGADAGSLVLVDATSAAGGLDVD 185 Query: 188 IAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKN 247 ++E D YYFAPQKNFASDGGLWL + SPAAL R + A+GRW+PDFL L A++NS N Sbjct: 186 VSEADVYYFAPQKNFASDGGLWLGLFSPAALERAARVKASGRWIPDFLDLQTAIDNSKLN 245 Query: 248 QTYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGL 307 QTYNTP+++TL L Q+ WL NGGLD+A RTADS+ R+YSWA+ Y TPFV Sbjct: 246 QTYNTPSLSTLVTLDAQVQWLNANGGLDFASARTADSAGRIYSWAEASEYATPFVAKAED 305 Query: 308 RSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTE 367 RS V+ TIDF D +DA +AK+LRANGIVDTEPYRKLGRNQLR+A F A+EP DVSAL Sbjct: 306 RSNVIATIDFDDSIDAAAIAKVLRANGIVDTEPYRKLGRNQLRIATFVAIEPADVSALLA 365 Query: 368 CVDWVVERL 376 +D+VV L Sbjct: 366 SIDYVVGEL 374 Lambda K H 0.317 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 376 Length adjustment: 30 Effective length of query: 346 Effective length of database: 346 Effective search space: 119716 Effective search space used: 119716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_058929976.1 AU252_RS06200 (phosphoserine transaminase)
to HMM TIGR01366 (putative phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01366.hmm # target sequence database: /tmp/gapView.23100.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01366 [M=361] Accession: TIGR01366 Description: serC_3: putative phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-188 611.6 3.4 2.9e-188 611.4 3.4 1.0 1 lcl|NCBI__GCF_001484605.1:WP_058929976.1 AU252_RS06200 phosphoserine tran Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001484605.1:WP_058929976.1 AU252_RS06200 phosphoserine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 611.4 3.4 2.9e-188 2.9e-188 2 360 .. 14 373 .. 13 374 .. 0.99 Alignments for each domain: == domain 1 score: 611.4 bits; conditional E-value: 2.9e-188 TIGR01366 2 padgrfgagpskvrleqlqalvataasllgtshrqaavknlvgkvreglaelfslpdgyevilgnggat 70 p+dgrfgagpskvr+eql+al+a++ ++lgtshrqa+vknlvg+vregl+++f+ p+gyev+lg gg+t lcl|NCBI__GCF_001484605.1:WP_058929976.1 14 PKDGRFGAGPSKVRPEQLEALSAASKTILGTSHRQAPVKNLVGSVREGLSQFFRAPEGYEVVLGVGGST 82 99******************************************************************* PP TIGR01366 71 afwdaatfgliekkslhlsfgefsskfakaaklapfldepeivtadpgsapeaqaeegvdvialahnet 139 afwd+a+fgl+ekk++hlsfgef skfa+a+++apfld i+ ++pg+ p + ae+gvdv+a+ net lcl|NCBI__GCF_001484605.1:WP_058929976.1 83 AFWDVASFGLVEKKAQHLSFGEFGSKFASATNKAPFLDASSIIKSEPGTRPVSAAEAGVDVYAWPQNET 151 ********************************************************************* PP TIGR01366 140 stgvavavrrpegsde.alvvidatsgagglpvdiketdvyyfapqksfasdgglwlavlspaalerie 207 stgva +v+r++g+d +lv++dats aggl vd++e+dvyyfapqk+fasdgglwl+++spaaler+ lcl|NCBI__GCF_001484605.1:WP_058929976.1 152 STGVAAPVKRVAGADAgSLVLVDATSAAGGLDVDVSEADVYYFAPQKNFASDGGLWLGLFSPAALERAA 220 ***************88**************************************************** PP TIGR01366 208 kiaasgrfvpeflslptavdnslknqtyntpavatlllldeqvdwlngnggldfavartkdsssrlysw 276 +++asgr++p+fl+l+ta+dns+ nqtyntp+++tl+ ld qv+wln+nggldfa art+ds+ r+ysw lcl|NCBI__GCF_001484605.1:WP_058929976.1 221 RVKASGRWIPDFLDLQTAIDNSKLNQTYNTPSLSTLVTLDAQVQWLNANGGLDFASARTADSAGRIYSW 289 ********************************************************************* PP TIGR01366 277 aeereyatpfvadaakrsqvvgtidfsddidaavvakilrangivdtepyrklgrnqlrvamfpaidpa 345 ae++eyatpfva a rs+v+ tidf+d+idaa++ak+lrangivdtepyrklgrnqlr+a f ai+pa lcl|NCBI__GCF_001484605.1:WP_058929976.1 290 AEASEYATPFVAKAEDRSNVIATIDFDDSIDAAAIAKVLRANGIVDTEPYRKLGRNQLRIATFVAIEPA 358 ********************************************************************* PP TIGR01366 346 dvealteavdfvvek 360 dv+al ++d+vv + lcl|NCBI__GCF_001484605.1:WP_058929976.1 359 DVSALLASIDYVVGE 373 ************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (376 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.47 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory