Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_058930724.1 AU252_RS10875 histidinol-phosphate transaminase
Query= reanno::BFirm:BPHYT_RS14905 (370 letters) >NCBI__GCF_001484605.1:WP_058930724.1 Length = 372 Score = 194 bits (492), Expect = 4e-54 Identities = 128/357 (35%), Positives = 187/357 (52%), Gaps = 20/357 (5%) Query: 10 VRAIAPYIAGKPISEVAREFGLDEATIVKLASNENPLGMPESAQRAMAQAASELGRYPDA 69 V + Y AGKP +D KL+SNENPL + A++ ++ RYPD Sbjct: 17 VSRLPRYAAGKP------PVAVDGLASYKLSSNENPLPPLPAVLEAISNQ-TDFNRYPDP 69 Query: 70 NAFELKAALSERYGVPADWVTLGNGSNDILEIAAHAFVE-----KGQSIVYAQYSFAVYA 124 + +L+AAL+E VPA+ V G GS L F K ++YA SF Y Sbjct: 70 LSSKLRAALAEFLAVPAEDVVTGAGSLGALNQLLSTFAGQNDDGKADEVIYAWRSFEAYP 129 Query: 125 LATQGLGARAIVVPAVKYG-HDLDAMLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLD 183 ++ +GA ++ +P G HDLDAM AAV+ T++I + PNNPTG + + E F+ Sbjct: 130 ISVGLVGAESVRIPLTAEGRHDLDAMAAAVTVRTKVILLCTPNNPTGPILTTAETERFIQ 189 Query: 184 KVPRHVVVVLDEAYTEYLPQEKRYDSIAWVRRYPNLLVSRTFSKAFGLAGLRVGFAIAQP 243 VP VVVV+DEAY E++ D IA R+YPN++V RTFSKA GLAGLRVG++++ P Sbjct: 190 AVPSDVVVVIDEAYQEFIRAGDAVDGIAMYRKYPNVVVLRTFSKAHGLAGLRVGYSVSNP 249 Query: 244 ELTDLLNRVRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFDKLGLEYVP 303 LT L PF V+ +A+ AAI +L + + + R+T +LG Sbjct: 250 VLTQYLRVAATPFAVSQIAENAAIVSLQNYPLVVERVQSIVDERTRVTSGLRELGWFVPE 309 Query: 304 SDGNFVLVRVGNDDAAGNRVNLELLKQGVIVRPVGNYGLPQWLRITIGLPEENEAFI 360 + GNFV + +G++ + + Q + VR G G +R++IG E N F+ Sbjct: 310 AQGNFVWLNLGDNSSEFAEL---AGTQALSVRAFGGDG----VRVSIGEAEANSRFL 359 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 372 Length adjustment: 30 Effective length of query: 340 Effective length of database: 342 Effective search space: 116280 Effective search space used: 116280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory