Align L-2-aminoadipate aminotransferase monomer (EC 2.6.1.39) (characterized)
to candidate WP_058930730.1 AU252_RS10910 PLP-dependent aminotransferase family protein
Query= metacyc::MONOMER-6727 (397 letters) >NCBI__GCF_001484605.1:WP_058930730.1 Length = 434 Score = 231 bits (589), Expect = 3e-65 Identities = 138/397 (34%), Positives = 210/397 (52%), Gaps = 16/397 (4%) Query: 10 FGKSAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVALQ 69 F + A I+ S +R++ ++ RPG++S AGG P + P E A AA I+ +G ALQ Sbjct: 39 FSERAANIKQSAVRDVFDISMRPGLVSLAGGSPYLQSLPLERLAATAASIIANEGLTALQ 98 Query: 70 YSPTEGYAPLRAFVAEWIGVR------PEEVLITTGSQQALDLVGKVFLDEGSPVLLEAP 123 Y +G LR + E + P V+IT GSQ A D+ KVF + G VL+E P Sbjct: 99 YGGGQGTEELRTQICEVMAAEGILDALPRNVVITAGSQSAQDVATKVFCNPGDVVLVENP 158 Query: 124 SYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKR-----ERPRFLYLIPSFQNPTGG 178 +Y+GA+ F TV ++G + LE + + +FLY IP+F NP+G Sbjct: 159 TYVGALNTFEAYQVEVATVEMDDDGLVPELLEARIAALQTAGKNIKFLYTIPNFNNPSGI 218 Query: 179 LTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSK 238 R+R++ + + ++V+ED+ Y L + L L R A VIY+GSFSK Sbjct: 219 TLAGERRQRVVDICRKANILVLEDNPYGLLRYNGTPLEPL----RAANPADVIYMGSFSK 274 Query: 239 VLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKE-GFSERLERVRRVY 297 + +PGLR+ +A+ ++ A + L P LNQMLV L + + ++E R +Y Sbjct: 275 IFAPGLRIGWALVPEHLQRRYYLASESVTLCPPTLNQMLVSAYLSDYDWKGQIETYRGLY 334 Query: 298 REKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAFVPGGPF 357 E+ AML ALD +P +T P+GG FVW+ LP G+ L ++A++ V F+PG F Sbjct: 335 AERCTAMLAALDEHMPAGTSWTSPEGGFFVWVTLPAGVDTYPLLQKAIDAGVVFIPGAAF 394 Query: 358 FANGGGENTLRLSYATLDREGIAEGVRRLGRALKGLL 394 + N LRL+++ + + I EGVRRL L+ L Sbjct: 395 TPSDSPSNKLRLAFSAVPPDAIKEGVRRLAPVLREAL 431 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 434 Length adjustment: 31 Effective length of query: 366 Effective length of database: 403 Effective search space: 147498 Effective search space used: 147498 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory