Align cystathionine gamma-lyase (EC 4.4.1.1); cysteine-S-conjugate beta-lyase (EC 4.4.1.13) (characterized)
to candidate WP_058930869.1 AU252_RS11760 O-succinylhomoserine sulfhydrylase
Query= BRENDA::A2RM21 (380 letters) >NCBI__GCF_001484605.1:WP_058930869.1 Length = 402 Score = 239 bits (610), Expect = 1e-67 Identities = 135/390 (34%), Positives = 232/390 (59%), Gaps = 14/390 (3%) Query: 3 SIKTKVIHGGIST---DKTTGAVSVP---IYQTSTYKQNGL-GQPKEYEYSRSGNPTRHA 55 S +T+ + GG+ +TT V + +Y+++ + G+ + + YSR GNP+ Sbjct: 11 SAETQAVRGGLDRTNFQETTEPVFLNSGFVYESAAAAERAFTGEDERFVYSRYGNPSVAT 70 Query: 56 LEELIADLEGGVQGFAFSSGLAGIHAVL-SLFSAGDHIILADDVYGGTFRLMDKVLTKTG 114 +E + LEG FA +SG++ + L +L +AGD ++ A ++G F +++++L + G Sbjct: 71 FQERLRLLEGTEACFATASGMSAVFTALGALLAAGDRVVAARSLFGSCFVILNEILPRWG 130 Query: 115 IIYDLVDLSNLDDLKAAFKEETKAIYFETPSNPLLKVLDIKEISAIAKAHDALTLVDNTF 174 + VD +L+ AA E T A++FE+PSNP+ +++DI +S +A A A +VDN F Sbjct: 131 VETVFVDGPDLEQWAAALSEPTTAVFFESPSNPMQEIVDIAAVSELAHAAGATVVVDNVF 190 Query: 175 ATPYLQQPIALGADIVLHSATKYLGGHSDVVAGLVTTNSKELASEIGFLQNSIGAVLGPQ 234 ATP LQ+ LGAD++++S TK++ G V+ G + + + + L G L Sbjct: 191 ATPLLQRCGQLGADVIVYSGTKHIDGQGRVLGGAILGTKEFIDGPVKQLMRHTGPALSAF 250 Query: 235 DSWLVQRGIKTLALRMEAHSANAQKIAEFLETSKAVSKVYYPGLNSHPGHEIAKKQMSAF 294 ++W++ +G++T+ALR+ SA+A ++AE+LE AVS V YP L SHP +E+A KQM A Sbjct: 251 NAWVLTKGLETMALRVNHSSASALRLAEWLEQQPAVSWVRYPLLKSHPQYELAAKQMKAG 310 Query: 295 GGMISFEL------TDENAVKDFVENLSYFTLAESLGGVESLIEVPAVMTHASIPKELRE 348 G +++ EL + + A ++ L ++ +LG +SLI PA TH ++ E R Sbjct: 311 GTVLTLELATTGGRSGKEAAFALLDALRIIDISNNLGDAKSLITHPATTTHRAMGPEGRA 370 Query: 349 EIGIKDGLIRLSVGVEAIEDLLTDIKEALE 378 IG+ DG++RLSVG+E ++DL+ D+++AL+ Sbjct: 371 AIGLSDGVVRLSVGLEDVDDLIGDLEQALK 400 Lambda K H 0.315 0.133 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 402 Length adjustment: 31 Effective length of query: 349 Effective length of database: 371 Effective search space: 129479 Effective search space used: 129479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory