Align dihydrodipicolinate synthase subunit (EC 4.3.3.7) (characterized)
to candidate WP_058931343.1 AU252_RS14615 5-dehydro-4-deoxyglucarate dehydratase
Query= metacyc::MONOMER-6565 (289 letters) >NCBI__GCF_001484605.1:WP_058931343.1 Length = 301 Score = 117 bits (294), Expect = 2e-31 Identities = 96/299 (32%), Positives = 150/299 (50%), Gaps = 20/299 (6%) Query: 1 MNFGNIATAMVTPFDKNENIDFQKLSKLIDYLLNNGTDSLVVAGTTGESPTLSEEEKVAL 60 M F + VTPF +D + L + I L+ G + A TGE LS +E + Sbjct: 1 MKFDGVLFFPVTPFTPEGTVDVELLKEHIGSRLSFGPGGVFPACGTGEFHALSIDEVRTV 60 Query: 61 IQYSVKEAAGRAPIIAGTGSNNTKASIKLTKKAEEAGADAVMLVTPYYNKPSQEGMYRHF 120 + +V+ AG P++AG G A + + AEEAGADA++++ PY +G+ + Sbjct: 61 VTAAVEVVAGTVPVVAGAGGPLGHA-VAAARVAEEAGADALLVLPPYLVTGPTDGLVAYI 119 Query: 121 RAIAEETSLPVMLYNVPGRTAASLAPETTIRLAEIPNIIAIKEASGDLDAITKIV----A 176 A+A+ +SLPV++Y+ R A + +RLA P +I K+ GD+ +IV A Sbjct: 120 EAVADASSLPVIVYH---RGNAKFTAASMVRLAANPKVIGFKDGLGDVGLAQEIVSAVRA 176 Query: 177 ETPEDFAVYSGDDSLTLPALSVGA-RG----IVSVASHIIGPEM-QEMIKHYTEGN-TAQ 229 EDFA ++G L L+ GA RG + S A+ + PE+ + Y G+ + Sbjct: 177 TGREDFAFFNG---LLTAELTQGAYRGLGIPLYSSAAFAMAPEIAKAYYDAYVSGDEDRR 233 Query: 230 AALIHQKLLPLMKGLFAAP--NPSPLKTALQLKGLDVGSVRLPLIPLNEDERLRLSSLM 286 AL+ PL++ P S +K L+L GL VG VR PL+ ED+ L+L S++ Sbjct: 234 NALLEGFYAPLVRLRDQTPGFGVSLVKAGLRLGGLPVGPVRPPLVDPTEDQLLQLKSIL 292 Lambda K H 0.313 0.131 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 301 Length adjustment: 26 Effective length of query: 263 Effective length of database: 275 Effective search space: 72325 Effective search space used: 72325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory