Align aspartate-semialdehyde dehydrogenase (characterized)
to candidate WP_058931682.1 AU252_RS16600 aspartate-semialdehyde dehydrogenase
Query= CharProtDB::CH_024631 (367 letters) >NCBI__GCF_001484605.1:WP_058931682.1 Length = 380 Score = 465 bits (1197), Expect = e-136 Identities = 234/367 (63%), Positives = 280/367 (76%), Gaps = 7/367 (1%) Query: 3 NVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTT----GTLQDAF 58 +VG +GWRGMVGSVLMQRM +E DF I PVFFSTS G AAPS G G L+DAF Sbjct: 8 SVGLVGWRGMVGSVLMQRMQDEGDFANINPVFFSTSNAGGAAPSIAGAAAGAAGKLEDAF 67 Query: 59 DLEALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDV 118 D++ L L IIVT QGGDYT ++ +LR GW G WIDAAS+LRM DD+II+LDP+N+DV Sbjct: 68 DVDTLAKLPIIVTAQGGDYTKRVHTELRGRGWDGLWIDAASTLRMNDDSIIVLDPINRDV 127 Query: 119 ITDGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQ 178 I GL NG + F+GGNCTVS MLM LGGLF N LV+W + TYQAASGGGARHMRELL+Q Sbjct: 128 IDKGLVNGTKDFIGGNCTVSCMLMGLGGLFKNGLVEWGTSMTYQAASGGGARHMRELLSQ 187 Query: 179 MGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQ 238 G L V+ EL P+SAIL+I+RKV RS ++ FGVPLAGSLIPWID L NGQ Sbjct: 188 FGTLNAEVSSELDDPASAILEIDRKVLAHQRS-DIDATQFGVPLAGSLIPWIDADLGNGQ 246 Query: 239 SREEWKGQAETNKILNTS--SVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLA 296 S+EEWK ETNKIL TS + I +DGLC+R+GA+R HSQA T+KL++D+S+ +E+LLA Sbjct: 247 SKEEWKAGVETNKILGTSDENRIIMDGLCIRIGAMRSHSQALTLKLREDLSVAEIEKLLA 306 Query: 297 AHNPWAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA 356 N WAKV+PN +E +M LTP A +GTL PVGR+RK+ MGPE++SAFTVGDQLLWGAA Sbjct: 307 DDNEWAKVIPNTKEDSMAGLTPVAASGTLDIPVGRIRKMEMGPEYISAFTVGDQLLWGAA 366 Query: 357 EPLRRML 363 EPLRRML Sbjct: 367 EPLRRML 373 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 380 Length adjustment: 30 Effective length of query: 337 Effective length of database: 350 Effective search space: 117950 Effective search space used: 117950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_058931682.1 AU252_RS16600 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01745.hmm # target sequence database: /tmp/gapView.22436.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01745 [M=366] Accession: TIGR01745 Description: asd_gamma: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-177 576.6 0.2 1.1e-177 576.4 0.2 1.0 1 lcl|NCBI__GCF_001484605.1:WP_058931682.1 AU252_RS16600 aspartate-semialde Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001484605.1:WP_058931682.1 AU252_RS16600 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 576.4 0.2 1.1e-177 1.1e-177 2 364 .. 8 375 .. 7 377 .. 0.97 Alignments for each domain: == domain 1 score: 576.4 bits; conditional E-value: 1.1e-177 TIGR01745 2 kvglvgwrgmvgsvllkrmqeekdfdaikpvffstsqlgqkapslakisa....iledaydidalkeld 66 vglvgwrgmvgsvl++rmq+e df i+pvffsts++g++aps+a+ +a leda+d+d+l +l lcl|NCBI__GCF_001484605.1:WP_058931682.1 8 SVGLVGWRGMVGSVLMQRMQDEGDFANINPVFFSTSNAGGAAPSIAGAAAgaagKLEDAFDVDTLAKLP 76 59*******************************************9765433448************** PP TIGR01745 67 iiitcqggdytkeiypklrkagwkgywidaasslrmkddaviildpvnldvikdavnkgirtfvggnct 135 ii+t qggdytk ++ +lr gw+g widaas+lrm+dd++i+ldp+n dvi+ ++ +g+++f+ggnct lcl|NCBI__GCF_001484605.1:WP_058931682.1 77 IIVTAQGGDYTKRVHTELRGRGWDGLWIDAASTLRMNDDSIIVLDPINRDVIDKGLVNGTKDFIGGNCT 145 ********************************************************************* PP TIGR01745 136 vslllmslgglfrdelvewvsvatyqaasgggarhmrellkqmgvlykeveeelakpssaileierkvt 204 vs +lm+lgglf+++lvew +++tyqaasgggarhmrell+q+g+l ev +el p+sailei+rkv lcl|NCBI__GCF_001484605.1:WP_058931682.1 146 VSCMLMGLGGLFKNGLVEWGTSMTYQAASGGGARHMRELLSQFGTLNAEVSSELDDPASAILEIDRKVL 214 ********************************************************************* PP TIGR01745 205 klsrseelpvenfsvplagslipwidkqldngqsreewkgqaetnkilgtkd..tilvdglcvrigalr 271 r +++ + +f+vplagslipwid +l ngqs+eewk etnkilgt+d i +dglc+riga+r lcl|NCBI__GCF_001484605.1:WP_058931682.1 215 AHQR-SDIDATQFGVPLAGSLIPWIDADLGNGQSKEEWKAGVETNKILGTSDenRIIMDGLCIRIGAMR 282 ****.79*******************************************8633699************ PP TIGR01745 272 chsqaltiklkkdvsleeieeiirahnkwvkvvpnereitlreltpaavtgtldipvgrlrklnmgkey 340 hsqalt+kl+ d+s+ eie++++++n+w+kv+pn +e+++ ltp a +gtldipvgr+rk++mg+ey lcl|NCBI__GCF_001484605.1:WP_058931682.1 283 SHSQALTLKLREDLSVAEIEKLLADDNEWAKVIPNTKEDSMAGLTPVAASGTLDIPVGRIRKMEMGPEY 351 ********************************************************************* PP TIGR01745 341 lsaftvgdqllwgaaeplrrmlri 364 +saftvgdqllwgaaeplrrml+i lcl|NCBI__GCF_001484605.1:WP_058931682.1 352 ISAFTVGDQLLWGAAEPLRRMLNI 375 **********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (366 nodes) Target sequences: 1 (380 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.96 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory