Align succinyldiaminopimelate transaminase (EC 2.6.1.17); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_058931843.1 AU252_RS17705 succinyldiaminopimelate transaminase
Query= BRENDA::Q82IK5 (364 letters) >NCBI__GCF_001484605.1:WP_058931843.1 Length = 382 Score = 402 bits (1034), Expect = e-117 Identities = 207/368 (56%), Positives = 255/368 (69%), Gaps = 11/368 (2%) Query: 8 LPTFPWDKLEPYKARAAAHPDGIVDLSVGTPVDPVPELIQKALVAAADSPGYPTVWGTPE 67 LP +PW+ + PY A+A+ HP G V+LS+GTPVDP P LIQ AL AAAD+PGYPTV GT Sbjct: 12 LPDYPWEAMTPYLAKASEHPGGAVNLSIGTPVDPTPALIQDALRAAADAPGYPTVHGTVP 71 Query: 68 LRDALTGWVERRLGARGVTHHHVLPIVGSKELVAWLPTQLGLGPGDKVAHPRLAYPTYEV 127 LR+A+ W ERR G G+ +++P VGSKELVAWLP LGL PGD V P++AYPTY++ Sbjct: 72 LREAIAAWFERRRGVPGLDPKNIMPTVGSKELVAWLPLLLGLKPGDVVVRPKVAYPTYDI 131 Query: 128 GARLARADHVVYDDPTELDPTG---LKLLWLNSPSNPTGKVLSKAELTRIVAWAREHGIL 184 GA A V D ELD ++L+W+NSP NPTG V L +VA ARE G + Sbjct: 132 GATFAGVTSVATDHLDELDNATRARVRLIWVNSPGNPTGSVRDVESLKALVAQARELGAV 191 Query: 185 VFSDECYLELGWEA-------DPV-SVLHPDVCGGSYEGIVSVHSLSKRSNLAGYRAAFL 236 V SDECY ELGW A +PV S+L P V GGS+EG+++V+SLSK+SN+AGYRAAF+ Sbjct: 192 VASDECYAELGWGAWDAQRGGEPVPSILDPRVSGGSHEGLLAVYSLSKQSNVAGYRAAFV 251 Query: 237 AGDPAVLGPLLQIRKHGGMMTSAPTQAAVVAALGDDAHVREQRERYAARRTALRDALLSH 296 AGDPA++ L+ RKH GM+ P Q A+ ALGDD HV+ Q++ Y RR L AL Sbjct: 252 AGDPAIMANLVNSRKHAGMIVPYPVQEAMRVALGDDTHVQAQKDLYRGRRERLVPALQGF 311 Query: 297 GFRIEHSEASLYLWATRGESCWDTVAHLADLGILVAPGDFYGSAGEQFVRVALTATDERV 356 G I+ S+A LYLW+T GES WDTVA LA+ GI+V PG FYG AG FVRVALT TDER+ Sbjct: 312 GLEIKDSDAGLYLWSTAGESTWDTVARLAERGIVVGPGVFYGEAGNGFVRVALTGTDERI 371 Query: 357 AAAVRRLA 364 AAV RLA Sbjct: 372 DAAVARLA 379 Lambda K H 0.319 0.135 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 550 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 382 Length adjustment: 30 Effective length of query: 334 Effective length of database: 352 Effective search space: 117568 Effective search space used: 117568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_058931843.1 AU252_RS17705 (succinyldiaminopimelate transaminase)
to HMM TIGR03539 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03539.hmm # target sequence database: /tmp/gapView.15772.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03539 [M=357] Accession: TIGR03539 Description: DapC_actino: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-177 574.2 0.8 5.7e-177 574.0 0.8 1.0 1 lcl|NCBI__GCF_001484605.1:WP_058931843.1 AU252_RS17705 succinyldiaminopim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001484605.1:WP_058931843.1 AU252_RS17705 succinyldiaminopimelate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 574.0 0.8 5.7e-177 5.7e-177 1 356 [. 12 378 .. 12 379 .. 0.98 Alignments for each domain: == domain 1 score: 574.0 bits; conditional E-value: 5.7e-177 TIGR03539 1 lPdfPWdklaeakakaashpdGivdlsvGtPvdpvpalirealaeaadapgyPqtaGteelreaivdal 69 lPd+PW++++++ aka++hp+G v+ls+GtPvdp+pali++al +aadapgyP+++Gt lreai++++ lcl|NCBI__GCF_001484605.1:WP_058931843.1 12 LPDYPWEAMTPYLAKASEHPGGAVNLSIGTPVDPTPALIQDALRAAADAPGYPTVHGTVPLREAIAAWF 80 8******************************************************************** PP TIGR03539 70 errlgvkgldeeavlPviGtkelvallPtllGlgagdtvviPevayPtyevgarlagaeavaaddltel 138 err+gv+gld+++++P++G+kelva+lP llGl++gd+vv+P+vayPty++ga++ag + va+d+l+el lcl|NCBI__GCF_001484605.1:WP_058931843.1 81 ERRRGVPGLDPKNIMPTVGSKELVAWLPLLLGLKPGDVVVRPKVAYPTYDIGATFAGVTSVATDHLDEL 149 ********************************************************************* PP TIGR03539 139 dp...ekvkliwlnsPanPtGrvlsveelrkvvalarergvvvasdecylelgWege........avsv 196 d+ ++v+liw+nsP+nPtG+v++ve+l+++va+are g+vvasdecy+elgW + ++s+ lcl|NCBI__GCF_001484605.1:WP_058931843.1 150 DNatrARVRLIWVNSPGNPTGSVRDVESLKALVAQARELGAVVASDECYAELGWGAWdaqrggepVPSI 218 99776789*********************************************97766779999999** PP TIGR03539 197 ldpevcggdlegllavhslskrsnlagyragfvaGdealvaellevrkhaGlmvpaPvqaamvaaladd 265 ldp+v+gg++egllav+slsk+sn+agyra+fvaGd+a++a+l+++rkhaG++vp+Pvq+am++al+dd lcl|NCBI__GCF_001484605.1:WP_058931843.1 219 LDPRVSGGSHEGLLAVYSLSKQSNVAGYRAAFVAGDPAIMANLVNSRKHAGMIVPYPVQEAMRVALGDD 287 ********************************************************************* PP TIGR03539 266 ehvaeqkeryaarrellkaalekaGfriehseaglylWatrgedaretvdrlaelGilvaPGdfygeag 334 +hv++qk++y+ rre+l +al+ +G++i+ s+aglylW+t+ge++++tv+rlae+Gi+v+PG fygeag lcl|NCBI__GCF_001484605.1:WP_058931843.1 288 THVQAQKDLYRGRRERLVPALQGFGLEIKDSDAGLYLWSTAGESTWDTVARLAERGIVVGPGVFYGEAG 356 ********************************************************************* PP TIGR03539 335 kefvrvaltatderiaaaverl 356 + fvrvalt+tderi+aav+rl lcl|NCBI__GCF_001484605.1:WP_058931843.1 357 NGFVRVALTGTDERIDAAVARL 378 *********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (357 nodes) Target sequences: 1 (382 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.54 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory