Align Metal-independent phosphoserine phosphatase; iPSP; Phosphoglycerate mutase-like protein 3; EC 3.1.3.3 (characterized)
to candidate WP_058932562.1 AU252_RS22255 histidine phosphatase family protein
Query= SwissProt::F4KI56 (238 letters) >NCBI__GCF_001484605.1:WP_058932562.1 Length = 194 Score = 88.6 bits (218), Expect = 8e-23 Identities = 68/190 (35%), Positives = 94/190 (49%), Gaps = 19/190 (10%) Query: 24 VTEIVLVRHGETTWNAAGRIQGQIESDLNEVGLKQAVAIAERLGKEERPVAVYSSDLKRA 83 +T L+RHG+T WNA R+QG + LN+VG QA + L E A+ SS L RA Sbjct: 3 LTTFALIRHGQTDWNAQRRLQGATDIPLNDVGRGQARDAVDVLSDYEWD-AIVSSPLSRA 61 Query: 84 KDTALMIAKTCFCPEVIEVPDLKERHVGSLQGLYWKEGAEKEPEAYSAFFSSQNDLEIPG 143 +TA +IA +P L ER G +GL+ A E EA L IPG Sbjct: 62 AETASVIADGLGLSVTRHIPALAERSFGPAEGLH----AGPELEA----------LRIPG 107 Query: 144 ---GGESFDQLADRSMDALEQIAKKHKGERVIVVTHGGVLRAIYLRITQASSAGKLLNAS 200 G ES + A R + ALE +A++ RV+VV HG +LR + L + ++ NA Sbjct: 108 GYRGAESEEDAAARGLGALEALAEEFPARRVLVVAHGTLLR-VSLNRAIGRTLHRIDNAV 166 Query: 201 VNVVHLRDQK 210 +N+ H K Sbjct: 167 LNLAHYHATK 176 Lambda K H 0.315 0.132 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 194 Length adjustment: 22 Effective length of query: 216 Effective length of database: 172 Effective search space: 37152 Effective search space used: 37152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory