Align Carbamoyl-phosphate synthase small chain; EC 6.3.5.5; Carbamoyl-phosphate synthetase glutamine chain (uncharacterized)
to candidate WP_066551598.1 A4249_RS06165 aminodeoxychorismate/anthranilate synthase component II
Query= curated2:Q8KGA2 (366 letters) >NCBI__GCF_001636925.1:WP_066551598.1 Length = 196 Score = 85.1 bits (209), Expect = 1e-21 Identities = 56/179 (31%), Positives = 83/179 (46%), Gaps = 12/179 (6%) Query: 189 NIIRQLNAEGCKVTVV-NAKTTADEVLAMNPDGIFLSNGPGDPFAVTYAIDTIRELAARN 247 N++ L G VV N T DE A+NP + LS GP P + I A Sbjct: 14 NLVHYLAELGAPTHVVRNDDLTVDEAWALNPAAVLLSPGPCAPDQAGICLPLITTAPA-- 71 Query: 248 STLPIFGICLGHQLLSLAFGAKTYKLKFGHHGANHPVKNLLSNTIE------ITSQNHGF 301 ++PI G+CLGHQ + AFG + K HG P+ + + ++ H Sbjct: 72 -SMPILGVCLGHQAIGQAFGGDVIRAKILMHGKTSPILHKGQSVFAGLPSPFTATRYHSL 130 Query: 302 AVEMESLPGELELTHKNLYDMTVEGIRHRELPCFSVQYHPEAAPGPHDSHYLFKEFTEL 360 AV+ E+LP +LE+T D + G++HR P VQ+HPE+ H H + F ++ Sbjct: 131 AVKRETLPDDLEVTAWTA-DGEIMGLQHRTRPIHGVQFHPESIATEH-GHDMLANFLDI 187 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 196 Length adjustment: 25 Effective length of query: 341 Effective length of database: 171 Effective search space: 58311 Effective search space used: 58311 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory