Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate WP_066918159.1 ACG33_RS01635 inositol-phosphate phosphatase
Query= reanno::azobra:AZOBR_RS03845 (260 letters) >NCBI__GCF_001579945.1:WP_066918159.1 Length = 256 Score = 163 bits (412), Expect = 4e-45 Identities = 103/254 (40%), Positives = 140/254 (55%), Gaps = 6/254 (2%) Query: 7 TPLVTLAERLADASGPVIRQYFRTPVAVDDKADASPVTIADREAERTIRAIIEAERPDDG 66 +P ++ A A A+ VIR+Y++ + V K D SPVT AD E E+ IR +I PD G Sbjct: 4 SPFLSAALDAARAAADVIRRYYQRNLEVVLKDDKSPVTRADVETEKVIRGLIGERFPDHG 63 Query: 67 IYGEEFGTKNLDAEWVWVIDPIDGTKSFITGRPIFGTLIALLHRGRPVLGVIDQPIVRDR 126 YGEE G +DA+++W++DPIDGTK+F+ P F T IAL+HRG ++GV P+ + Sbjct: 64 FYGEETGQSAIDADYLWLVDPIDGTKAFVREYPFFSTQIALMHRGHLIVGVSSAPVYGEI 123 Query: 127 WLGVEGRPTLFNGQPARVRECAGGLAAATLGTTSPDLFPGADQDAF-RRVAGAAKVSVYG 185 G +G+P RV E A G L G + R V A+++ Y Sbjct: 124 AYAQAGEGAWLDGRPIRVSEIDAIEQCAISGGNLKTLAAGPGWARYGRLVERASRIRGY- 182 Query: 186 GDCYSYGLLAAGYYDLVVESGLKLYDFAALVPVVTGAGGLMTDWDGR-PLDATSSGRVVA 244 GD Y LLAAG D+V+ES + + D AAL +V AGG TD GR P T+S V Sbjct: 183 GDFLHYHLLAAGKIDVVIESDVNILDIAALAVIVEAAGGRFTDLQGRAPTLQTTS---VV 239 Query: 245 AGDARTHRETLAAL 258 A +AR H E LA+L Sbjct: 240 ATNARLHEEVLASL 253 Lambda K H 0.320 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 256 Length adjustment: 24 Effective length of query: 236 Effective length of database: 232 Effective search space: 54752 Effective search space used: 54752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory