Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate WP_066918431.1 ACG33_RS02555 ribose-phosphate pyrophosphokinase
Query= BRENDA::P0A719 (315 letters) >NCBI__GCF_001579945.1:WP_066918431.1 Length = 317 Score = 394 bits (1011), Expect = e-114 Identities = 193/310 (62%), Positives = 252/310 (81%) Query: 4 MKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPT 63 M +FAG+A +LA IA + LG A+VGRFSDGE +V++ ENVRG DIFI+Q T P Sbjct: 6 MAVFAGSANRQLAHDIARHMMVPLGRASVGRFSDGETTVELLENVRGRDIFIVQPTSPPA 65 Query: 64 NDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVD 123 N+++MEL+VMVDA RRASA RITAV+PYFGYARQDRR R+ RVPITAK+VA+ ++S GVD Sbjct: 66 NEHVMELLVMVDACRRASAARITAVVPYFGYARQDRRPRATRVPITAKLVANMIASAGVD 125 Query: 124 RVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAKL 183 RVLTVDLHA+QIQGFFD+PVDNV+ SP+LL D+ + DN +VVSPD+GGVVRARA+AK Sbjct: 126 RVLTVDLHADQIQGFFDIPVDNVYASPVLLGDVWRRKYDNLMVVSPDVGGVVRARALAKR 185 Query: 184 LNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKR 243 L+D ++AIIDKRRPRAN S+VM+IIG+VAG+ CVLVDD++DT GTLC AA+ALK+ GA++ Sbjct: 186 LDDAELAIIDKRRPRANESEVMNIIGEVAGKTCVLVDDLVDTAGTLCHAAQALKKAGAQK 245 Query: 244 VFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAIRRI 303 V+AY TH + SG A + S +DE+VV DTIPLS+ + +R L+++G+LAE +RRI Sbjct: 246 VYAYITHAVLSGPAIERITKSDLDELVVTDTIPLSEAARQCTKIRQLSVAGLLAETMRRI 305 Query: 304 SNEESISAMF 313 +EES+S+++ Sbjct: 306 RDEESVSSLY 315 Lambda K H 0.321 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 317 Length adjustment: 27 Effective length of query: 288 Effective length of database: 290 Effective search space: 83520 Effective search space used: 83520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_066918431.1 ACG33_RS02555 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.25110.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-123 398.1 0.4 1.2e-123 397.9 0.4 1.0 1 lcl|NCBI__GCF_001579945.1:WP_066918431.1 ACG33_RS02555 ribose-phosphate p Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001579945.1:WP_066918431.1 ACG33_RS02555 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.9 0.4 1.2e-123 1.2e-123 1 308 [. 6 315 .. 6 316 .. 0.98 Alignments for each domain: == domain 1 score: 397.9 bits; conditional E-value: 1.2e-123 TIGR01251 1 lkilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmell 69 + +++gs++++la+ +a+++ ++lg+++v +F+dgE+ v++ e+vrg+d+fi+ q ts+p n+++mell lcl|NCBI__GCF_001579945.1:WP_066918431.1 6 MAVFAGSANRQLAHDIARHMMVPLGRASVGRFSDGETTVELLENVRGRDIFIV-QPTSPPANEHVMELL 73 679**************************************************.*************** PP TIGR01251 70 llidalkrasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqiqgfFd 137 +++da++rasa ++tav+Py+gYaRqd++ + r pi+aklva+++++aG+drvltvdlH++qiqgfFd lcl|NCBI__GCF_001579945.1:WP_066918431.1 74 VMVDACRRASAARITAVVPYFGYARQDRRPRaTRVPITAKLVANMIASAGVDRVLTVDLHADQIQGFFD 142 ****************************98758************************************ PP TIGR01251 138 vpvenlsaspklieelkkkelknlvvvsPDkGaverakkvakklg.lelaiieKeRdskenevevtnll 205 +pv+n++asp+l+ ++ +++ +nl+vvsPD G+v ra+++ak+l+ +elaii+K+R+ ++ne ev+n++ lcl|NCBI__GCF_001579945.1:WP_066918431.1 143 IPVDNVYASPVLLGDVWRRKYDNLMVVSPDVGGVVRARALAKRLDdAELAIIDKRRP-RANESEVMNII 210 *********************************************9***********.889******** PP TIGR01251 206 gdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv 274 g+v+gk++v+vDD+++T+gTl++aa++Lk++GA+kv++++th+v+sg+A+er++++ ++e++vt+ti+ lcl|NCBI__GCF_001579945.1:WP_066918431.1 211 GEVAGKTCVLVDDLVDTAGTLCHAAQALKKAGAQKVYAYITHAVLSGPAIERITKSDLDELVVTDTIPL 279 ********************************************************************* PP TIGR01251 275 .ee.kklpkvseisvapliaeaiarihenesvsslf 308 e +++ k++++sva l+ae+++ri+++esvssl+ lcl|NCBI__GCF_001579945.1:WP_066918431.1 280 sEAaRQCTKIRQLSVAGLLAETMRRIRDEESVSSLY 315 65589*****************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (317 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.39 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory