Align Putative [LysW]-L-2-aminoadipate/[LysW]-L-glutamate phosphate reductase; EC 1.2.1.103; EC 1.2.1.106 (uncharacterized)
to candidate WP_066922138.1 ACG33_RS14140 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:Q9YBY8 (355 letters) >NCBI__GCF_001579945.1:WP_066922138.1 Length = 355 Score = 173 bits (438), Expect = 7e-48 Identities = 115/361 (31%), Positives = 173/361 (47%), Gaps = 23/361 (6%) Query: 1 MARAVRAGILGASGMTGGELLRILASHPGVEVEWATSREYAGKPVHTAHPHLRGFYTGLK 60 M + A +LG +G GELLR++A+HPGVE++ S G+P+ PHL Y LK Sbjct: 3 MTEKIPAIVLGGTGYVAGELLRLIAAHPGVELKGILSDSQPGEPLGKWFPHLAPVYPNLK 62 Query: 61 YTSIDKIDIGEVDV----VFNALPHGVGASIV------AEAYENGVRVVDLSADYRLRDQ 110 ++ ++ I + + +A PHGV A ++ AEA RV+D+SADYR Sbjct: 63 FSDLETISRLAASLPAAAILSAAPHGVAAGLIDQLLCAAEAGGTNPRVIDISADYRYASA 122 Query: 111 SLYPKLYGFKHPRPDLLEEAIYALPEIYGEKLRGARLAAVPGCNATAAILAAAPLVASKI 170 Y +Y H P + + ALPE + E + +A PGC +TA +L + PL+ + Sbjct: 123 QAYEAVYPHAHGAPHRVAQFTCALPE-HLETVNTPHVAH-PGCFSTAVLLPSVPLLKLGL 180 Query: 171 IDMDVGIIVDVKAASSEAGSKPSRHSIHPLREGSARPYTPWGHRHAAEAVQVLRDLVGRG 230 I+ + V S+ +G P+ + HP R Y P HRHA E + + G Sbjct: 181 IEPR--LFVTGVTGSTGSGRTPTAGTHHPQRHSDFYAYNPLAHRHAPEIAAIAQTASGVA 238 Query: 231 IRLSLVPHAVSMTRGVLASAHALLRDNIGFSEAVRAYASFYKDSQIVRVKPMAPGLPVDP 290 S VPH+ RG+ + A+ R ++ E + A FY+ VRV Sbjct: 239 AEFSFVPHSGPFARGIHVTVQAVARRSLKTPELLDALREFYRGKPFVRVSGAM------- 291 Query: 291 PDVKNVIGSMFAEVGFAVEEESGRITGFAAIDNLVRGAAGQAVYAMNAMLGFDEWEGLRS 350 P VK+V S +A +G A G + DNL +GAAG A+ +N + G +E GL + Sbjct: 292 PHVKDVTSSNYAVIGGAA--NGGTVVLTCVEDNLTKGAAGGAIQWLNRLFGIEETAGLTA 349 Query: 351 P 351 P Sbjct: 350 P 350 Lambda K H 0.319 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 355 Length adjustment: 29 Effective length of query: 326 Effective length of database: 326 Effective search space: 106276 Effective search space used: 106276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory