Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate WP_066922139.1 ACG33_RS14145 aspartate aminotransferase family protein
Query= curated2:C3P3K3 (396 letters) >NCBI__GCF_001579945.1:WP_066922139.1 Length = 413 Score = 172 bits (437), Expect = 1e-47 Identities = 123/378 (32%), Positives = 193/378 (51%), Gaps = 30/378 (7%) Query: 19 YHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRA 78 Y +P+ + AEGV++ P+G + +DL ++ G+ HP+ + AL QA + S A Sbjct: 44 YAQVPLEVQDAEGVYLHTPDGRKVLDLYGGHAVAALGYGHPRWLQALNSQARSLCFQSNA 103 Query: 79 FHSDQLGPWYEKVAKLTNK--EMVLPMNTGAEAVETAIKTARRWAYDVKKVEANRAEIIV 136 D K+A + V +N+GAEA E A+K A R + I+ Sbjct: 104 VPLDVRRRAAAKLANFCGLGLDTVFFVNSGAEANENALKLACRMTGGTR--------IVA 155 Query: 137 CEDNFHGRTM--GAVSMSSNEEYKRGFGPMLP-GIIVIPYGDLEALKAAITPNTAAFILE 193 E +FHGR+ GAV+ + +++ GF P LP + I D++ L I +TAA I+E Sbjct: 156 VEGSFHGRSAAAGAVTWGARQKWY-GF-PQLPFDVTFIKPSDMDRLGTLIDEHTAAVIVE 213 Query: 194 PIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYIL 253 P+QG AG P FL+ C + + + DE+Q G+GRTG FA + +TPD+ Sbjct: 214 PVQGVAGAVDLPKEFLQALRLRCSENGTILIFDEVQCGVGRTGYPFAANMYEITPDIITT 273 Query: 254 GKALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACAVSIAALEVLEEEKLTE--- 310 KALG G FP+S + + + G+TFGG PLACAV A +++++ E+L E Sbjct: 274 AKALGAG-FPVSAMLLADHVAAYCKLDAMGTTFGGGPLACAVVEAVIDIIDSEQLLENVR 332 Query: 311 -RSLQLGEK-LVGQLKEIDNPMITEVRGKGLFIGIELNEPARPYCEQLKAAGLLCKETHE 368 RS+Q+ E +VG I +G GL +G+ + PA+ +L +L + + Sbjct: 333 LRSVQIRESCVVGP--------ILGTQGAGLLLGLRTSRPAKEVQSELLKMDILTGTSGD 384 Query: 369 -NVIRIAPPLVISEEDLE 385 +V+RI P V+ E +E Sbjct: 385 PHVLRILAPYVLQSEHVE 402 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 413 Length adjustment: 31 Effective length of query: 365 Effective length of database: 382 Effective search space: 139430 Effective search space used: 139430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory