Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_068166058.1 HTA01S_RS00070 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_001592305.1:WP_068166058.1 Length = 386 Score = 491 bits (1265), Expect = e-143 Identities = 245/379 (64%), Positives = 288/379 (75%), Gaps = 9/379 (2%) Query: 5 ALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVG 64 ALL L DGT F G +IGATG GEVVFNT++TGYQEILTDPSY +QIVTLTYPHIGN G Sbjct: 8 ALLALADGTVFTGISIGATGQTTGEVVFNTALTGYQEILTDPSYCQQIVTLTYPHIGNTG 67 Query: 65 TNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLRE 124 N D E+++VHA GL+I+DLPL+ASNFR+ E LS YL+R VAIAD+DTR LTR LR Sbjct: 68 VNREDVEATRVHAAGLIIKDLPLLASNFRSEETLSHYLQREGTVAIADLDTRALTRRLRT 127 Query: 125 KGAQNGCIIA---GDN---PDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLT 178 GAQNGCI+A G++ A AL A+A P + G DLAK V+ E Y+WTQ W L Sbjct: 128 HGAQNGCILALAPGESITDEHRARALAAAQAAPNMAGQDLAKVVSAREPYAWTQTEWQLG 187 Query: 179 GGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFL 238 G E + FHVVAYDFG K NILRML RGC++T+VPAQT A DV K+ P G+FL Sbjct: 188 FGYGE---QIAPKFHVVAYDFGVKHNILRMLSARGCKITVVPAQTPASDVFKLKPSGVFL 244 Query: 239 SNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVK 298 SNGPGDP PCDYAI A ++ +++ +P FGICLGHQ++ALASGAKT KMKFGHHG NHPVK Sbjct: 245 SNGPGDPEPCDYAIAATREIIDSGVPTFGICLGHQIMALASGAKTFKMKFGHHGANHPVK 304 Query: 299 DVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASP 358 D++ V IT+QNHGFAVDE LPA LR TH SLFDGTLQG+ RTD+PAF FQGHPEASP Sbjct: 305 DLDSGRVSITSQNHGFAVDEKDLPATLRATHVSLFDGTLQGLARTDRPAFCFQGHPEASP 364 Query: 359 GPHDAAPLFDHFIELIEQY 377 GPHD LFD FIEL++++ Sbjct: 365 GPHDIGYLFDRFIELMQKH 383 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 386 Length adjustment: 30 Effective length of query: 352 Effective length of database: 356 Effective search space: 125312 Effective search space used: 125312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_068166058.1 HTA01S_RS00070 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.27475.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-145 471.1 0.0 1.3e-145 470.9 0.0 1.0 1 lcl|NCBI__GCF_001592305.1:WP_068166058.1 HTA01S_RS00070 carbamoyl-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001592305.1:WP_068166058.1 HTA01S_RS00070 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 470.9 0.0 1.3e-145 1.3e-145 1 361 [] 8 382 .. 8 382 .. 0.95 Alignments for each domain: == domain 1 score: 470.9 bits; conditional E-value: 1.3e-145 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk 69 a l+l+dGtvf+g+s+ga+++++GevvFnT++tGYqEiltDpsY +qiv+ltyp+ign+gvn+ed+e++ lcl|NCBI__GCF_001592305.1:WP_068166058.1 8 ALLALADGTVFTGISIGATGQTTGEVVFNTALTGYQEILTDPSYCQQIVTLTYPHIGNTGVNREDVEAT 76 579****************************************************************** PP TIGR01368 70 kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse.... 134 +++++gl++k+l +sn+r++e+L+++l++eg vai+++DTRal+++lR++g+++++i + + lcl|NCBI__GCF_001592305.1:WP_068166058.1 77 RVHAAGLIIKDLPLLASNFRSEETLSHYLQREGTVAIADLDTRALTRRLRTHGAQNGCILALAPGesit 145 **********************************************************98755334455 PP TIGR01368 135 ...keelvekakespkvkevnlvkevstkeayeleq...k.....akkegkklrvvvidlGvKenilre 192 + ++ ++a+++p++++++l+k vs++e+y+++q + ++ k +vv++d+GvK+nilr+ lcl|NCBI__GCF_001592305.1:WP_068166058.1 146 dehRARALAAAQAAPNMAGQDLAKVVSAREPYAWTQtewQlgfgyGEQIAPKFHVVAYDFGVKHNILRM 214 5445667778889**********************9665166665667777899*************** PP TIGR01368 193 LvkrgvevtvvpadtsaeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllal 261 L++rg+++tvvpa+t+a+++ kl+p+g++lsnGPGdP+ +++ai+ +++++++ +P+fGIclGhq++al lcl|NCBI__GCF_001592305.1:WP_068166058.1 215 LSARGCKITVVPAQTPASDVFKLKPSGVFLSNGPGDPEPCDYAIAATREIIDSGVPTFGICLGHQIMAL 283 ********************************************************************* PP TIGR01368 262 algaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkel 330 a+gakt+k+kfGh+GaNhpvkdl++grv+itsqNHg+avde+ l+++ l++thv+l+Dgt++gl++++ lcl|NCBI__GCF_001592305.1:WP_068166058.1 284 ASGAKTFKMKFGHHGANHPVKDLDSGRVSITSQNHGFAVDEKDLPAT-LRATHVSLFDGTLQGLARTDR 351 *******************************************8866.********************* PP TIGR01368 331 pvfsvQyHPeaspGphdteylFdefvelikk 361 p+f Q HPeaspGphd ylFd+f+el++k lcl|NCBI__GCF_001592305.1:WP_068166058.1 352 PAFCFQGHPEASPGPHDIGYLFDRFIELMQK 382 ****************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.80 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory