GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisH in Hydrogenophaga taeniospiralis NBRC 102512

Align Imidazole glycerol phosphate synthase subunit HisH; EC 4.3.2.10; IGP synthase glutaminase subunit; EC 3.5.1.2; IGP synthase subunit HisH; ImGP synthase subunit HisH; IGPS subunit HisH (uncharacterized)
to candidate WP_068166269.1 HTA01S_RS00490 cobyric acid synthase

Query= curated2:Q7NNK4
         (226 letters)



>NCBI__GCF_001592305.1:WP_068166269.1
          Length = 488

 Score = 50.4 bits (119), Expect = 6e-11
 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 5/98 (5%)

Query: 14  VGNLHSARKGLEAMGARVTLSGQPLTLSAADGVVLPGVGSFDTAITRLNDRGLGDAIIQL 73
           + NL   +      G R+  +  P   + AD +VLPG  +    +  L  +GL  A+   
Sbjct: 266 ISNLDEFQPLKNVPGLRLVWARTPADCAGADWIVLPGSKATSADLAWLRAQGLDRAVAAH 325

Query: 74  VRAGQPMLGICLGLQVLFDS-----SEEGRLPGLGLLP 106
              G  +LG+C GLQVL ++       +G  PGLGLLP
Sbjct: 326 AALGGAVLGVCGGLQVLGEALIDPHGIDGNAPGLGLLP 363


Lambda     K      H
   0.322    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 266
Number of extensions: 13
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 226
Length of database: 488
Length adjustment: 28
Effective length of query: 198
Effective length of database: 460
Effective search space:    91080
Effective search space used:    91080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory