Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate WP_068169213.1 HTA01S_RS08380 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >NCBI__GCF_001592305.1:WP_068169213.1 Length = 390 Score = 429 bits (1102), Expect = e-125 Identities = 221/381 (58%), Positives = 268/381 (70%), Gaps = 9/381 (2%) Query: 4 TQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTK----NIWLRRGT- 58 T +L L +ELI+R SVTP D CQ LA RL +GFA E L G N+W RRG Sbjct: 2 TATLRLTEELIARASVTPLDAGCQAQLASRLSALGFACETLESGPADFRVTNLWARRGRG 61 Query: 59 KAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVA 118 P + FAGHTDVVPTGP+E W S PF P+ RDG+LYGRGA+DMK S+A V ACE F+A Sbjct: 62 DQPTLVFAGHTDVVPTGPLEAWASDPFVPSHRDGKLYGRGASDMKASLAAMVVACEEFIA 121 Query: 119 KHPNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNG 178 +P IA L+TSDEEG A DGT V L+ R E +D+CIVGEPT+V++ GDMIKNG Sbjct: 122 SNPAPGIDIAFLLTSDEEGPANDGTVIVCRELQRRGERLDWCIVGEPTSVERTGDMIKNG 181 Query: 179 RRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNI 238 RRG++SG LTVKG QGHIAYP LA NP+H APAL EL VWD GN +FPPTS+QISNI Sbjct: 182 RRGTMSGKLTVKGIQGHIAYPQLARNPIHMVAPALAELVATVWDAGNAFFPPTSWQISNI 241 Query: 239 NGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ----YDLQWSCSGQP 294 +GGTGA+NVIPG + + FNFRFST ST GL+QRV IL + G++ +DL W+ G P Sbjct: 242 HGGTGASNVIPGTVVIDFNFRFSTASTPEGLQQRVADILQRQGLRACTDFDLDWTVGGLP 301 Query: 295 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINE 354 FLT+ G L D RAAI GI+ +LSTTGGTSDGRFI + ++IELGP NATIH+I+E Sbjct: 302 FLTEPGPLVDAVRAAIRAETGIDTQLSTTGGTSDGRFIAQVCPQVIELGPPNATIHKIDE 361 Query: 355 NVRLNDIPKLSAVYEGILARL 375 +V + DI L +Y L +L Sbjct: 362 HVAVADIEPLKNIYRRTLDQL 382 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 390 Length adjustment: 30 Effective length of query: 351 Effective length of database: 360 Effective search space: 126360 Effective search space used: 126360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_068169213.1 HTA01S_RS08380 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.13045.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-149 482.7 0.0 4.2e-149 482.5 0.0 1.0 1 lcl|NCBI__GCF_001592305.1:WP_068169213.1 HTA01S_RS08380 succinyl-diaminop Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001592305.1:WP_068169213.1 HTA01S_RS08380 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 482.5 0.0 4.2e-149 4.2e-149 3 370 .] 6 382 .. 4 382 .. 0.97 Alignments for each domain: == domain 1 score: 482.5 bits; conditional E-value: 4.2e-149 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefe....dtknlwatrgt.eepvlvfaGhtDv 66 l++eLi r svtP dag+q+ +a+rL++lgf++e+le + ++nlwa+rg ++p+lvfaGhtDv lcl|NCBI__GCF_001592305.1:WP_068169213.1 6 RLTEELIARASVTPLDAGCQAQLASRLSALGFACETLESGpadfRVTNLWARRGRgDQPTLVFAGHTDV 74 6899*********************************9984433479*******9889*********** PP TIGR01246 67 vPaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeai 135 vP+G+le+W sdpf p++rdGklygrGa Dmk+slaa+vva+e+f+++n+ +++l+tsDeeg a lcl|NCBI__GCF_001592305.1:WP_068169213.1 75 VPTGPLEAWASDPFVPSHRDGKLYGRGASDMKASLAAMVVACEEFIASNPAPGIDIAFLLTSDEEGPAN 143 **************************************************9877*************** PP TIGR01246 136 dGtkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhka 204 dGt+ v l+ r e +d+++vgeP+sv++ GD+ik+GrrG ++gkl++kGiqGh+aYP++a+nP+h + lcl|NCBI__GCF_001592305.1:WP_068169213.1 144 DGTVIVCRELQRRGERLDWCIVGEPTSVERTGDMIKNGRRGTMSGKLTVKGIQGHIAYPQLARNPIHMV 212 ********************************************************************* PP TIGR01246 205 vpvlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekild 273 +p+l+el+a+ +D Gn+ffpp+s qi+ni++gtgasnviPg + + fn+rfs+ ++ e l+++v++il+ lcl|NCBI__GCF_001592305.1:WP_068169213.1 213 APALAELVATVWDAGNAFFPPTSWQISNIHGGTGASNVIPGTVVIDFNFRFSTASTPEGLQQRVADILQ 281 ********************************************************************* PP TIGR01246 274 khkl....dYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelG 338 +++l d++l+w++ g pflt+ g l+++v++ai+ +++ ++lst+GGtsD+rfia++ +v+elG lcl|NCBI__GCF_001592305.1:WP_068169213.1 282 RQGLractDFDLDWTVGGLPFLTEPGPLVDAVRAAIRAETGIDTQLSTTGGTSDGRFIAQVCPQVIELG 350 *96544449************************************************************ PP TIGR01246 339 lvndtihkvneavkiedleklsevyeklleel 370 + n+tihk++e+v ++d+e l+++y+++l +l lcl|NCBI__GCF_001592305.1:WP_068169213.1 351 PPNATIHKIDEHVAVADIEPLKNIYRRTLDQL 382 **************************999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.66 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory