Align Homoserine O-acetyltransferase; HAT; EC 2.3.1.31; Homoserine transacetylase; HTA (uncharacterized)
to candidate WP_068170716.1 HTA01S_RS10920 homoserine O-acetyltransferase
Query= curated2:Q1QQD3 (399 letters) >NCBI__GCF_001592305.1:WP_068170716.1 Length = 391 Score = 371 bits (953), Expect = e-107 Identities = 185/372 (49%), Positives = 242/372 (65%), Gaps = 17/372 (4%) Query: 30 FAGDQPLPLDCGIDLAPFQIAYQTYGELNAGKSNAILVCHALTGDQHVANVH------PV 83 F D PLPL G L +++ +TYG LNA +SNA+LVCHAL HVA H P+ Sbjct: 8 FRFDTPLPLKSGATLPAYELVVETYGTLNADRSNAVLVCHALNASHHVAGWHADANGQPL 67 Query: 84 TGKPGWWVTLVGPGKPLDTDKYFVICSNVIGGCMGSTGPASTNPATGTVWGLDFPVITIP 143 GWW +++GP K +DTDK+FVI N +G C GSTGP TNPATG WG DFPV+T+ Sbjct: 68 PRSEGWWHSMIGPSKAVDTDKWFVIGVNNLGSCFGSTGPTHTNPATGQPWGADFPVVTVE 127 Query: 144 DMVRAQAMLIDRLGIDTLFSVVGGSMGGMQVLQWCVAYPQRVFSALPIACSTRHSAQNIA 203 D V AQA L+D +GI+ L +V+GGS+GGMQ L W + YP+RV A+ +A + +A+NIA Sbjct: 128 DWVNAQARLLDVMGIEQLAAVMGGSLGGMQTLSWTLQYPERVRHAIVVASAPNLTAENIA 187 Query: 204 FHELGRQAVMADPDWRDGRYVEQGTYPHRGLGVARMAAHITYLSDAALHRKFGR--RMQD 261 F+E+ R+A++ DPD+ G Y+ +GT P RGL +ARM HITYLSD ++ KFGR R + Sbjct: 188 FNEVARRAIVTDPDFHGGHYLREGTLPRRGLRIARMIGHITYLSDDVMNEKFGRSLRTAN 247 Query: 262 RDLPT---------FSFDADFQVESYLRHQGSSFVERFDANSYLYLTRAMDYFDIAADHN 312 D P + D +FQ+ESYLR+QG F E FDAN+YL +TRA+DYFD A +H Sbjct: 248 GDDPADTAELAYRYTTQDVEFQIESYLRYQGDKFSEYFDANTYLLITRALDYFDPAREHG 307 Query: 313 GVLAAAFRDTRTRFCVVSFTSDWLFPTSESRATVHALNAGGARVSFAEIETDRGHDAFLL 372 G L+AA + RF +VSFT+DW F + SR V AL G VS+AEI+ GHDAFLL Sbjct: 308 GSLSAALARAKARFLLVSFTTDWRFSPARSREMVKALLENGRDVSYAEIDAPHGHDAFLL 367 Query: 373 DLPEFFDIAHAF 384 D P + A+ Sbjct: 368 DDPRYHQAVRAY 379 Lambda K H 0.323 0.136 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 399 Length of database: 391 Length adjustment: 31 Effective length of query: 368 Effective length of database: 360 Effective search space: 132480 Effective search space used: 132480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
Align candidate WP_068170716.1 HTA01S_RS10920 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.9077.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-139 450.7 0.0 2e-139 450.5 0.0 1.0 1 lcl|NCBI__GCF_001592305.1:WP_068170716.1 HTA01S_RS10920 homoserine O-acet Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001592305.1:WP_068170716.1 HTA01S_RS10920 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.5 0.0 2e-139 2e-139 3 350 .. 12 380 .. 10 381 .. 0.95 Alignments for each domain: == domain 1 score: 450.5 bits; conditional E-value: 2e-139 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.......GWWdellGp 64 ++l l+sG++l+ +e++++tyGtlna+r+NavlvcHal +s+hvag + + + GWW++++Gp lcl|NCBI__GCF_001592305.1:WP_068170716.1 12 TPLPLKSGATLPAYELVVETYGTLNADRSNAVLVCHALNASHHVAGWHADANGqplprseGWWHSMIGP 80 6899*****************************************9887554468999*********** PP TIGR01392 65 graldtsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavv 133 +a+dt+++fv+++N+lGsc GstgP+ +np+tg+p+ga+fP+vt++D+v+aq++lld +g+e+laav+ lcl|NCBI__GCF_001592305.1:WP_068170716.1 81 SKAVDTDKWFVIGVNNLGSCFGSTGPTHTNPATGQPWGADFPVVTVEDWVNAQARLLDVMGIEQLAAVM 149 ********************************************************************* PP TIGR01392 134 GgSlGGmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGL 201 GgSlGGmq+l w+l+yperv++++v+a++++++a++iafnev+r+ai +Dp++++G+y +e+ P++GL lcl|NCBI__GCF_001592305.1:WP_068170716.1 150 GGSLGGMQTLSWTLQYPERVRHAIVVASAPNLTAENIAFNEVARRAIVTDPDFHGGHYLREGtLPRRGL 218 ************************************************************9999***** PP TIGR01392 202 alARmlalltYrseesleerfgreaksee...........slass...leeefsvesylryqgkkfver 256 ++ARm++++tY+s++ ++e+fgr+ ++++ ++ ef++esylryqg+kf e lcl|NCBI__GCF_001592305.1:WP_068170716.1 219 RIARMIGHITYLSDDVMNEKFGRSLRTANgddpadtaelaY---RyttQDVEFQIESYLRYQGDKFSEY 284 ***********************999988776666654431...1333599****************** PP TIGR01392 257 FdAnsYllltkaldthdlargrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..y 323 FdAn+Yll+t+ald++d ar++ +sl++al+++ka++l+v++++D++f++++++e++kal +++ + y lcl|NCBI__GCF_001592305.1:WP_068170716.1 285 FDANTYLLITRALDYFDPAREHGGSLSAALARAKARFLLVSFTTDWRFSPARSREMVKALLENGRDvsY 353 ***********************************************************998877778* PP TIGR01392 324 aeieseeGHDaFllekekveelirefl 350 aei+ ++GHDaFll++ ++++++r+++ lcl|NCBI__GCF_001592305.1:WP_068170716.1 354 AEIDAPHGHDAFLLDDPRYHQAVRAYF 380 ***********************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.97 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory