Align histidinol dehydrogenase (EC 1.1.1.23) (characterized)
to candidate WP_068174408.1 HTA01S_RS19435 histidinol dehydrogenase
Query= BRENDA::Q8G2R2 (430 letters) >NCBI__GCF_001592305.1:WP_068174408.1 Length = 447 Score = 402 bits (1032), Expect = e-116 Identities = 209/422 (49%), Positives = 289/422 (68%), Gaps = 4/422 (0%) Query: 11 DFEQKFAAFLSGKREVSEDVDRAVREIVDRVRREGDSALLDYSRRFDRIDLEKT-GIAVT 69 DFE +FAA L E +++ V +I+ V++ GD+A+L+Y+ RFD ++ + + +T Sbjct: 16 DFEARFAARLHWSAETDSAIEQRVADILADVQQRGDAAVLEYTARFDGLNADGVPALELT 75 Query: 70 EAEIDAAFDAAPASTVEALKLARDRIEKHHARQLPKDDR---YTDALGVELGSRWTAIEA 126 +AE+ AAFD PA+ +AL+ A R+ +H Q Y D G LG + T ++ Sbjct: 76 QAELKAAFDGLPAAQRDALESAARRVRSYHEAQKRASGESWSYRDEDGTLLGQKVTPLDR 135 Query: 127 VGLYVPGGTASYPSSVLMNAMPAKVAGVDRIVMVVPAPDGNLNPLVLVAARLAGVSEIYR 186 VG+YVPGG A+YPSSVLMNA+PA VAGV I+MVVP P G NPLVL AA +AGV+ + Sbjct: 136 VGIYVPGGKAAYPSSVLMNAIPAHVAGVAEIIMVVPTPKGEKNPLVLAAAYVAGVTRAFT 195 Query: 187 VGGAQAIAALAYGTETIRPVAKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVLIVADKD 246 +GGAQA+AALAYGT T+ V KI GPGNAYVA+AK+ VFGTVGIDMIAGPSE+L++AD Sbjct: 196 IGGAQAVAALAYGTATVPKVDKITGPGNAYVASAKKRVFGTVGIDMIAGPSEILVLADGS 255 Query: 247 NNPDWIAADLLAQAEHDTAAQSILMTNDEAFAHAVEEAVERQLHTLARTETASASWRDFG 306 DW+A DL +QAEHD AQSIL+ D A+ AV+ A++R L T+ R + S D G Sbjct: 256 TPADWVAMDLFSQAEHDELAQSILLCPDAAYIDAVQAAIDRLLPTMPRAAIIAKSLNDRG 315 Query: 307 AVILVKDFEDAIPLANRIAAEHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIGDYVGGC 366 A+IL +D E+A ++NRIA EHLE++ ++ + P +++AG+IF+G YT E +GDY G Sbjct: 316 ALILTRDMEEACAISNRIAPEHLEVSSSEPHRWEPLLKHAGAIFLGAYTSESLGDYCAGP 375 Query: 367 NHVLPTARSARFSSGLSVLDYMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAHAQSVAI 426 NHVLPT+ +ARFSS L V D+ KR+SL+++ + + LG A E+A EGL AHA++ + Sbjct: 376 NHVLPTSGTARFSSPLGVYDFQKRSSLIEVSAAGAQTLGIIAAELAYGEGLQAHARAAEL 435 Query: 427 RL 428 RL Sbjct: 436 RL 437 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 447 Length adjustment: 32 Effective length of query: 398 Effective length of database: 415 Effective search space: 165170 Effective search space used: 165170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_068174408.1 HTA01S_RS19435 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.1655.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-160 518.6 0.3 7.1e-160 518.4 0.3 1.0 1 lcl|NCBI__GCF_001592305.1:WP_068174408.1 HTA01S_RS19435 histidinol dehydr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001592305.1:WP_068174408.1 HTA01S_RS19435 histidinol dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 518.4 0.3 7.1e-160 7.1e-160 1 393 [] 39 436 .. 39 436 .. 0.98 Alignments for each domain: == domain 1 score: 518.4 bits; conditional E-value: 7.1e-160 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkvkle...slrvseeeleealeavdeelkealelaaeniekfhek 66 v++i++dv+++Gd+A+leyt +fd+++++ +l+++++el++a + ++++ ++ale aa++++++he+ lcl|NCBI__GCF_001592305.1:WP_068174408.1 39 VADILADVQQRGDAAVLEYTARFDGLNADgvpALELTQAELKAAFDGLPAAQRDALESAARRVRSYHEA 107 789***********************66534489*********************************** PP TIGR00069 67 qlpes...veveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdg 132 q+++s +++++e+g+llgqkv+pl+rvg+YvPgGkaaypS+vlm+a+pA+vAgv ei++v P+ +g lcl|NCBI__GCF_001592305.1:WP_068174408.1 108 QKRASgesWSYRDEDGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVAEIIMVVPTP-KG 175 *9876667*********************************************************6.9* PP TIGR00069 133 kvnpavlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaG 201 + np vlaaa ++gv++ +++GGaqa+aalayGt+tvpkvdki+GPGn+yV+ AKk vfg+vgidmiaG lcl|NCBI__GCF_001592305.1:WP_068174408.1 176 EKNPLVLAAAYVAGVTRAFTIGGAQAVAALAYGTATVPKVDKITGPGNAYVASAKKRVFGTVGIDMIAG 244 ********************************************************************* PP TIGR00069 202 PsEvlviadesanpelvaaDllsqaEHdedaqailvttseelaekveeeveeqleelerkeiaekslek 270 PsE+lv+ad s+ +++va+Dl+sqaEHde aq+il++++++ +++v++++++ l +++r+ i+ ksl++ lcl|NCBI__GCF_001592305.1:WP_068174408.1 245 PSEILVLADGSTPADWVAMDLFSQAEHDELAQSILLCPDAAYIDAVQAAIDRLLPTMPRAAIIAKSLND 313 ********************************************************************* PP TIGR00069 271 ngaiilvddleealelsneyApEHLelqtkdpeellkkiknaGsvflGeytpealgdyvaGpnhvLPTs 339 +ga+il++d+eea+++sn++ApEHLe+ ++p+++ + +k+aG++flG+yt+e+lgdy+aGpnhvLPTs lcl|NCBI__GCF_001592305.1:WP_068174408.1 314 RGALILTRDMEEACAISNRIAPEHLEVSSSEPHRWEPLLKHAGAIFLGAYTSESLGDYCAGPNHVLPTS 382 ********************************************************************* PP TIGR00069 340 gtArfasglsvedFlkrisvqelskealeelaeaveklaeaEgLeaHaeavevR 393 gtArf+s+l+v+dF+kr+s++e+s +++++l+ +++la EgL+aHa+a+e R lcl|NCBI__GCF_001592305.1:WP_068174408.1 383 GTARFSSPLGVYDFQKRSSLIEVSAAGAQTLGIIAAELAYGEGLQAHARAAELR 436 **************************************************9988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (447 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.42 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory