Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_068176166.1 HTA01S_RS23370 PLP-dependent aminotransferase family protein
Query= BRENDA::A0A060PQX5 (417 letters) >NCBI__GCF_001592305.1:WP_068176166.1 Length = 396 Score = 313 bits (801), Expect = 8e-90 Identities = 171/395 (43%), Positives = 244/395 (61%), Gaps = 9/395 (2%) Query: 23 SKKALGMKASEVRELLKLVESSDVISLAGGLPAPETFPVEIIAEITKEVLEKHAAQALQY 82 +++A M S +RE+LK+ E +IS AGGLP+P+TFPV+ AE +VL ALQY Sbjct: 8 ARRAERMNPSVIREILKVTEKPGIISFAGGLPSPKTFPVDAFAEACAQVLRTDGRAALQY 67 Query: 83 GTTKGFTPLRLALAEWMRKRYDIPISKVDIMITSGSQQALDLIGRVFINPGDIVVVEAPT 142 +++G+ PLR E + + + ++IT+GSQQ LDL+ +V I+ G V+VE PT Sbjct: 68 ASSEGYAPLR----EMIAAQLPWDVDPAQVLITTGSQQGLDLVAKVLIDSGSRVLVETPT 123 Query: 143 YLAALQAFKYYEPEFVQIPLDDEGMRVDLLEEKLQELEKEGKKVKLVYTIPTFQNPAGVT 202 YL ALQAF EPE V + D EG+ VD LE K ++ + +Y +P FQNP G T Sbjct: 124 YLGALQAFAPMEPEVVSVASDAEGVDVDDLERKTGH---GAERARFLYVLPNFQNPTGRT 180 Query: 203 MSEKRRKRLLELASEYDFLIVEDNPYGELRYSGEPVKPIKAWDDEGRVMYLGTFSKILAP 262 MSE RR+ L+E A+ +VEDNPYG+L + P KP+ A EG + YLG+FSK+LAP Sbjct: 181 MSEARRQALVERAAAIGLPLVEDNPYGDLWFDQPPPKPLTARHPEGCI-YLGSFSKVLAP 239 Query: 263 GFRIGWIAAEPHLIRKLEIAKQSVDLCTNPFSQVIAWKYVEGGHLDNHIPNIIEFYKPRR 322 G R+G++ A ++ KL AKQ+ DL + F+Q + + ++ G L+ H+P I YK + Sbjct: 240 GLRLGYVVAPKAIMPKLLQAKQAADLHSPSFNQRMVAEVLKDGFLERHVPTIRALYKRQC 299 Query: 323 DAMLKALE-EFMPEGVRWTKPEGGMFVWVTLPEGIDTKLMLEKAVAKGVAYVPGEAFFAH 381 AML AL+ E V+W P+GGMF+WV LPEG+ +L KAV KGVA+VPG AF+A Sbjct: 300 AAMLDALKTEMAGLNVQWNSPDGGMFLWVRLPEGMSAVELLPKAVDKGVAFVPGAAFYAS 359 Query: 382 RDVKNTMRLNFTYVPEEKIREGIKRLAETIKEEMK 416 +RL+F E+I G+ LA+ I+E+ + Sbjct: 360 EPDPRALRLSFVTASVEQIHIGVAALAQAIREQQQ 394 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 396 Length adjustment: 31 Effective length of query: 386 Effective length of database: 365 Effective search space: 140890 Effective search space used: 140890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory