Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate WP_068462935.1 APY04_RS12025 aspartate-semialdehyde dehydrogenase
Query= SwissProt::P23247 (337 letters) >NCBI__GCF_001541235.1:WP_068462935.1 Length = 342 Score = 325 bits (833), Expect = 1e-93 Identities = 167/333 (50%), Positives = 228/333 (68%), Gaps = 6/333 (1%) Query: 5 FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDW 64 + VA+ GATG VG M+ VL EREFP DE++ +AS RS G F KT++ ++E+FD+ Sbjct: 3 YKVAVVGATGNVGREMMNVLAEREFPADEVYAIASRRSLGTEVSFGDKTLKCHDIEQFDF 62 Query: 65 SQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNR 124 S+ L SAG ++ +W P A G +VIDN+S++RYD D+PL+VPEVN +A+A + + Sbjct: 63 SKADFCLMSAGSTVAKEWGPRIAATGCIVIDNSSYWRYDQDVPLIVPEVNADAVAGYTKK 122 Query: 125 NIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKL-LNGY 183 NIIANPNCST Q++VALKP++DA I+R+ V+TYQSVSGAGK +DEL QT + + G Sbjct: 123 NIIANPNCSTAQLVVALKPLHDAATIKRVVVSTYQSVSGAGKEAMDELWQQTKGMYVPGA 182 Query: 184 PAETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVPVFY 243 E F++QIAFNCIP ID FM++GYTKEE KM+ ET+KI DP I + TCVRVPVF Sbjct: 183 EVEAKKFTKQIAFNCIPHIDVFMEDGYTKEEWKMLAETKKIL-DPKIKLTATCVRVPVFV 241 Query: 244 GHAEAVHVETRAPIDAEQVMDMLEQTDGIELF---RGADFPTQVRDAGGKDHVLVGRVRN 300 GH+EAV +E PI AE+ +L + GI + + T V +A G+ V R+R Sbjct: 242 GHSEAVTIEFENPISAEEARAILREAPGIMVVDKREPGGYVTPV-EAAGEFATYVSRIRE 300 Query: 301 DISHHSGINLWVVADNVRKGAATNAVQIAELLV 333 D + +G+ LW+V+DN+ KGAA N VQIAE ++ Sbjct: 301 DATVENGLQLWIVSDNLLKGAALNTVQIAETII 333 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 342 Length adjustment: 28 Effective length of query: 309 Effective length of database: 314 Effective search space: 97026 Effective search space used: 97026 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_068462935.1 APY04_RS12025 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.3697307.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-144 465.4 0.2 6e-144 465.2 0.2 1.0 1 NCBI__GCF_001541235.1:WP_068462935.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001541235.1:WP_068462935.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 465.2 0.2 6e-144 6e-144 1 337 [. 4 333 .. 4 335 .. 0.98 Alignments for each domain: == domain 1 score: 465.2 bits; conditional E-value: 6e-144 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgsv 73 +va+vGatG+vG+e+++vL+er+fp+d+++++as+rs G++v f +k l+ +++e+++f++ d l+saG++v NCBI__GCF_001541235.1:WP_068462935.1 4 KVAVVGATGNVGREMMNVLAEREFPADEVYAIASRRSLGTEVSFGDKTLKCHDIEQFDFSKADFCLMSAGSTV 76 69*********************************************************************** PP TIGR01296 74 skefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklk 146 +ke+ p++a++g+iviDn+s +r d+dvPL+vpevna+ ++ kk+iianPnCst qlvv+Lkpl+d+a +k NCBI__GCF_001541235.1:WP_068462935.1 77 AKEWGPRIAATGCIVIDNSSYWRYDQDVPLIVPEVNADAVAGYTKKNIIANPNCSTAQLVVALKPLHDAATIK 149 ************************************************************************* PP TIGR01296 147 rvvvstYqavsGaGkkgveeLknqtkavleg.kekepeidalkakkfakqiafnaiplidklkedGytkeelk 218 rvvvstYq+vsGaGk++++eL +qtk +++ +e ++akkf+kqiafn ip+id ++edGytkee k NCBI__GCF_001541235.1:WP_068462935.1 150 RVVVSTYQSVSGAGKEAMDELWQQTKGMYVPgAE-------VEAKKFTKQIAFNCIPHIDVFMEDGYTKEEWK 215 **************************99874044.......368***************************** PP TIGR01296 219 llfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlyptPlea 291 +l et+kil+ +++k++atcvrvPvf+ghse+v+iefe+++s+ee++ +L+eapg++v+d+ + y+tP+ea NCBI__GCF_001541235.1:WP_068462935.1 216 MLAETKKILD-PKIKLTATCVRVPVFVGHSEAVTIEFENPISAEEARAILREAPGIMVVDKREPGGYVTPVEA 287 **********.************************************************************** PP TIGR01296 292 vgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaelli 337 +g+ +++v+rir+D + e+gl+l++v+Dnl+kGaaln+vqiae++i NCBI__GCF_001541235.1:WP_068462935.1 288 AGEFATYVSRIREDATVENGLQLWIVSDNLLKGAALNTVQIAETII 333 *******************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 22.07 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory