Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate WP_072905195.1 BUB13_RS02510 3-isopropylmalate dehydrogenase
Query= BRENDA::D2YZL2 (364 letters) >NCBI__GCF_900142125.1:WP_072905195.1 Length = 362 Score = 452 bits (1162), Expect = e-132 Identities = 220/355 (61%), Positives = 282/355 (79%) Query: 2 SYQIAVLAGDGIGPEVMAEARKVLAAVEKRFDLSIEYSEYDVGGAAIDNHGCPLPEATLK 61 +Y++AVL GDGIGPEVMAEA KVL A+EK++D+S E + +VGGA IDN G LP++T++ Sbjct: 4 TYKVAVLPGDGIGPEVMAEALKVLDAIEKKYDVSFERTTANVGGAGIDNEGKALPDSTVE 63 Query: 62 GCEAADAVLFGSVGGPKWEHLPPNDQPERGALLPLRGHFELFCNMRPAKLHPGLEHMSPL 121 C+A+DA+LFGSVGGPKWE LPP++QPERGALLPLR F LFCN+RPA + P L S L Sbjct: 64 ICKASDAILFGSVGGPKWESLPPDEQPERGALLPLRKIFGLFCNLRPAIIFPALTGASSL 123 Query: 122 RSDISEKGFDILCVRELTGGIYFGKPKGRQGEGENEEAFDTMRYSRKEIRRIAKIAFESA 181 + ++ E GFD+L VRELTGGIYF +PKG +GEG FDTM+YS E+ RI +AFE+A Sbjct: 124 KEEVIEGGFDLLVVRELTGGIYFAEPKGIEGEGAARTGFDTMKYSDAEVERITHVAFEAA 183 Query: 182 QGRRKKVTSVDKANVLACSVLWREVVEEVAKDYPDVELEHIYIDNATMQLLRRPNEFDVM 241 + R KKV S+DKANVL+ SVLWREVVE VAK+YPDVEL H+Y+DNA MQL++ P +FDVM Sbjct: 184 RKRGKKVCSIDKANVLSTSVLWREVVERVAKEYPDVELSHMYVDNAAMQLVKWPKQFDVM 243 Query: 242 LCSNLFGDIVSDEIAMLTGSMGLLASISMNSQGFGMYEPAGGSAPDIAGQGIANPVAQIL 301 LC N+FGDI+SDE AMLTGS+G+L S S+ FGMYEP+GGSAPDIAGQGIANP+AQIL Sbjct: 244 LCGNMFGDIISDEAAMLTGSLGMLPSASLAEGSFGMYEPSGGSAPDIAGQGIANPIAQIL 303 Query: 302 SAALLLRHSLKLEDAALAIEAAVSKALSDGYLTCELLPASERSQAKSTSQMGDYI 356 SA+++LR+S + +AA AI+AAV K L+DGY T ++ + + +T+++GD I Sbjct: 304 SASMMLRYSFGMIEAADAIDAAVEKTLNDGYRTGDIYQGTASEKKVNTAEIGDAI 358 Lambda K H 0.317 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 362 Length adjustment: 29 Effective length of query: 335 Effective length of database: 333 Effective search space: 111555 Effective search space used: 111555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_072905195.1 BUB13_RS02510 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.25644.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-161 523.0 0.0 1.9e-161 522.8 0.0 1.0 1 lcl|NCBI__GCF_900142125.1:WP_072905195.1 BUB13_RS02510 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900142125.1:WP_072905195.1 BUB13_RS02510 3-isopropylmalate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 522.8 0.0 1.9e-161 1.9e-161 1 347 [. 6 356 .. 6 358 .. 0.97 Alignments for each domain: == domain 1 score: 522.8 bits; conditional E-value: 1.9e-161 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlg 69 k+avLpGDgiGpev+aealkvL+a+e+++++++e +a++GGa id+ g+ lp+ t++ ck++da+L+g lcl|NCBI__GCF_900142125.1:WP_072905195.1 6 KVAVLPGDGIGPEVMAEALKVLDAIEKKYDVSFERTTANVGGAGIDNEGKALPDSTVEICKASDAILFG 74 79******************************************************************* PP TIGR00169 70 avGGpkWdnlprdvrPek.gLLklrkeldlfanLrPaklfksLeklsplkeeiv.kgvDlvvvreLtgG 136 +vGGpkW++lp+d +Pe+ +LL+lrk ++lf+nLrPa +f++L+ +s+lkee++ g+Dl+vvreLtgG lcl|NCBI__GCF_900142125.1:WP_072905195.1 75 SVGGPKWESLPPDEQPERgALLPLRKIFGLFCNLRPAIIFPALTGASSLKEEVIeGGFDLLVVRELTGG 143 ******************88**********************************558************ PP TIGR00169 137 iYfGepkereeaeeekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveei 205 iYf epk++e+++ ++++dt+kY+ e+eri++vafe+arkr kkv+s+DkanvL +s lWr++ve + lcl|NCBI__GCF_900142125.1:WP_072905195.1 144 IYFAEPKGIEGEGAARTGFDTMKYSDAEVERITHVAFEAARKRGKKVCSIDKANVLSTSVLWREVVERV 212 ********************************************************************* PP TIGR00169 206 akeyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfe 274 akeyPdvel+h+y+DnaamqLvk P+q+dv++++n+fGDi+sDea+++tGslG+LPsasl++ ++++e lcl|NCBI__GCF_900142125.1:WP_072905195.1 213 AKEYPDVELSHMYVDNAAMQLVKWPKQFDVMLCGNMFGDIISDEAAMLTGSLGMLPSASLAEGSFGMYE 281 ********************************************************************* PP TIGR00169 275 pvhgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvleegkrtedlaseat..tavs 341 p +gsapdiag+gianpia+ilsa+++lrys+++ eaa+ai+aav+k+l++g+rt d+++ ++ ++v lcl|NCBI__GCF_900142125.1:WP_072905195.1 282 PSGGSAPDIAGQGIANPIAQILSASMMLRYSFGMIEAADAIDAAVEKTLNDGYRTGDIYQGTAseKKVN 350 **********************************************************98654115667 PP TIGR00169 342 tkevee 347 t+e+++ lcl|NCBI__GCF_900142125.1:WP_072905195.1 351 TAEIGD 356 777766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (362 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.26 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory