Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_072906776.1 BUB13_RS05995 imidazole glycerol phosphate synthase subunit HisF
Query= BRENDA::P16250 (240 letters) >NCBI__GCF_900142125.1:WP_072906776.1 Length = 255 Score = 102 bits (255), Expect = 6e-27 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 21/246 (8%) Query: 6 LLPAVDVRDGQAVRLVHGESGTETSYGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRA 65 ++P +DV+DG+ V+ V+ + G P+EAA A+ GA+ L +D+ A+ DNR Sbjct: 6 IIPCLDVKDGRVVKGVNFVGLRDA--GDPVEAAEAYDAQGADELTFLDITAS---SDNRD 60 Query: 66 LIAEV----AQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEH 121 I +V A+ + + + + GGIR + + L G +V++ TAA+ PE+V + Sbjct: 61 TIVDVVRRTAERVFMPLTVGGGIRSCEDIRKMLNAGADKVSINTAAVFNPEFVKEAAERF 120 Query: 122 GDKIAV-GLDVR----GTTLRGRGWTRDGG-----DLYETLDRLNKEGCARYVVTDIAKD 171 G + V +D R LR +T G D E ++ G ++T + D Sbjct: 121 GSQCTVVAIDARRVPDSDPLRWEVYTHGGRKPTGIDAIEWAKKMVDYGSGEILLTSMDGD 180 Query: 172 GTLQGPNLELLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFT 231 GT G ++EL + V A D PV+ASGGV +L+ +R GLV G A+ + K +T Sbjct: 181 GTKAGYDIELTRAVSDAVDVPVIASGGVGNLEHIR--EGLVEGGASAALAASIFHFKEYT 238 Query: 232 LEEALE 237 + E E Sbjct: 239 IAECKE 244 Lambda K H 0.315 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 255 Length adjustment: 24 Effective length of query: 216 Effective length of database: 231 Effective search space: 49896 Effective search space used: 49896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory