Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_072906806.1 BUB13_RS06080 homoserine O-acetyltransferase
Query= SwissProt::B3E278 (367 letters) >NCBI__GCF_900142125.1:WP_072906806.1 Length = 373 Score = 487 bits (1253), Expect = e-142 Identities = 226/366 (61%), Positives = 286/366 (78%), Gaps = 2/366 (0%) Query: 2 SIGVVHEQTITFEAGIRLESGRILAPITLVYELYGTMNADCSNVIMVEHAWTGDAHLAGK 61 S+G+V + F+ +RLESGR+L P+T+ +E YG +NA NVI+V HAWTGDAH AG Sbjct: 4 SVGLVKTEYADFDVELRLESGRLLGPLTIAFERYGQLNAAKDNVILVTHAWTGDAHAAGV 63 Query: 62 RREDDPKPGWWDAIVGPGRLLDTDRYCVLCSNVIGSCYGSTGPASINPRTGKRYNLSFPV 121 E+D KPGWWD ++GPG++ DTD+Y VLCSNVIGSC GSTGP SI+P+TG+ Y L FP Sbjct: 64 HDEEDRKPGWWDNMIGPGKVFDTDKYFVLCSNVIGSCKGSTGPTSIDPKTGRPYRLKFPS 123 Query: 122 ITVRDMVRAQELLLDHLGIRRLLCVMGGSMGGMQALEWATQYPERVASVVALATTPRPSP 181 + VRDMVRAQ+LL+DHLGI + V+GGSMG MQA+EWA YPE + ++V +A T R SP Sbjct: 124 LMVRDMVRAQKLLIDHLGITSIHAVVGGSMGAMQAIEWAIHYPEMIRAIVPIAGTGRTSP 183 Query: 182 QAISLNAVARWAIYNDPTWKKGEYK--HNPKDGLALARGIGHITFLSDESMWQKFERRFS 239 AI+LNA+AR AI+NDP WKKG Y+ H P DGLALAR +GHI+FLSD SMW KF RRFS Sbjct: 184 MAIALNALARQAIFNDPLWKKGNYRPEHPPADGLALARAVGHISFLSDASMWLKFGRRFS 243 Query: 240 AKDGLFDFFGQFEVERYLNYNGYNFVDRFDANCFLYLAKALDLYDVAWGYESMTDAFSRI 299 +DG+FDFFG+FE+ERYL+YNG NFVDRFD N FLYLAKALDLYDVAW ++S+++A R+ Sbjct: 244 VRDGMFDFFGKFEIERYLDYNGGNFVDRFDTNSFLYLAKALDLYDVAWNFDSLSEALDRL 303 Query: 300 TAPIQFFAFSSDWLYPPYQTEEMVTCLQGLGKEVEYHLIQSAYGHDAFLLEHETFTPMVR 359 P +FAF+SDWLY P QT+E+V L+ L K V+YHLI+S YGHD+FL+E E F P+++ Sbjct: 304 NCPSLWFAFTSDWLYTPQQTQEVVDELRRLNKPVDYHLIESDYGHDSFLVEPEKFIPILQ 363 Query: 360 SLLERV 365 + L V Sbjct: 364 TFLAEV 369 Lambda K H 0.323 0.138 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 472 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 373 Length adjustment: 30 Effective length of query: 337 Effective length of database: 343 Effective search space: 115591 Effective search space used: 115591 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate WP_072906806.1 BUB13_RS06080 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.20705.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-134 431.9 0.0 1e-133 431.7 0.0 1.0 1 lcl|NCBI__GCF_900142125.1:WP_072906806.1 BUB13_RS06080 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900142125.1:WP_072906806.1 BUB13_RS06080 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 431.7 0.0 1e-133 1e-133 4 350 .. 18 366 .. 15 367 .. 0.98 Alignments for each domain: == domain 1 score: 431.7 bits; conditional E-value: 1e-133 TIGR01392 4 eltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgraldt 70 el lesG l +++a+++yG+lna++dN++lv Ha tg+ah+ag +deed+ GWWd+++Gpg+ +dt lcl|NCBI__GCF_900142125.1:WP_072906806.1 18 ELRLESGRLLGPLTIAFERYGQLNAAKDNVILVTHAWTGDAHAAGVHDEEDRkpGWWDNMIGPGKVFDT 86 799*********************************************998889*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 ++yfv+c+Nv+GsckGstgP+si+p+tg+py+ +fP + +rD+v+aqk l+d+Lg+++++avvGgS+G lcl|NCBI__GCF_900142125.1:WP_072906806.1 87 DKYFVLCSNVIGSCKGSTGPTSIDPKTGRPYRLKFPSLMVRDMVRAQKLLIDHLGITSIHAVVGGSMGA 155 ********************************************************************* PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGLalARmla 208 mqa+ewa++ype++++iv++a + r+s++aia+n+++rqai +Dp +++G+y+ e+ P+ GLalAR ++ lcl|NCBI__GCF_900142125.1:WP_072906806.1 156 MQAIEWAIHYPEMIRAIVPIAGTGRTSPMAIALNALARQAIFNDPLWKKGNYRPEHPPADGLALARAVG 224 ********************************************************************* PP TIGR01392 209 lltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdlarg 277 +++++s++s+ +fgr+ + ++ ++ + +f++e yl+y+g +fv+rFd ns+l+l+kald +d+a + lcl|NCBI__GCF_900142125.1:WP_072906806.1 225 HISFLSDASMWLKFGRRFSVRD-GMFDFFGKFEIERYLDYNGGNFVDRFDTNSFLYLAKALDLYDVAWN 292 ***************9998885.577799***************************************9 PP TIGR01392 278 rrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekvee 344 dsl+eal+++++p+l +++sD+l+t+++++e++++l++ ++ y+ ies++GHD+Fl+e ek+ lcl|NCBI__GCF_900142125.1:WP_072906806.1 293 -FDSLSEALDRLNCPSLWFAFTSDWLYTPQQTQEVVDELRRLNKPvdYHLIESDYGHDSFLVEPEKFIP 360 .8***************************************999889********************** PP TIGR01392 345 lirefl 350 +++ fl lcl|NCBI__GCF_900142125.1:WP_072906806.1 361 ILQTFL 366 *99997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (373 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.46 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory